Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282770_IP8.jpg IP (Immunoprecipitation) (Immunoprecipitation analysis of 300 ug extracts of HepG2 cells using 3 ug ACC1 antibody (AAA282770). Western blot was performed from the immunoprecipitate using ACC1 (AAA282770) at a dilution of 1:1000.)

Rabbit anti-Human ACC1 Monoclonal Antibody | anti-ACACA antibody

ACC1 Rabbit mAb

Reactivity
Human
Applications
ELISA, Immunoprecipitation, Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
ACC1, Antibody; ACC1 Rabbit mAb; ACC; ACAC; ACC1; ACCA; Acac1; hACC1; ACACAD; ACCalpha; ACACalpha; anti-ACACA antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
RLAKQSRHLEVQILADQYGNAISLFGRDCSVQRRHQKIIEEAPATIATPAVFEHMEQCAVKLAKMVGYVSAGTVEYLYSQDGSFYFLELNPRLQVEHPCTE
Applicable Applications for anti-ACACA antibody
ELISA, IP (Immunoprecipitation), IHC (Immunohistochemistry), WB (Western Blot)
Cross Reactivity
Human, Mouse, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 350-450 of human ACC1 (Q13085).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IP (Immunoprecipitation)

(Immunoprecipitation analysis of 300 ug extracts of HepG2 cells using 3 ug ACC1 antibody (AAA282770). Western blot was performed from the immunoprecipitate using ACC1 (AAA282770) at a dilution of 1:1000.)

product-image-AAA282770_IP8.jpg IP (Immunoprecipitation) (Immunoprecipitation analysis of 300 ug extracts of HepG2 cells using 3 ug ACC1 antibody (AAA282770). Western blot was performed from the immunoprecipitate using ACC1 (AAA282770) at a dilution of 1:1000.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Rat kidney using ACC1 Rabbit mAb (AAA282770) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.)

product-image-AAA282770_IHC10.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Rat kidney using ACC1 Rabbit mAb (AAA282770) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.)

IHC (Immunohistochemisry)

(Immunohistochemistry analysis of paraffin-embedded Mouse testis using ACC1 Rabbit mAb (AAA282770) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.)

product-image-AAA282770_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry analysis of paraffin-embedded Mouse testis using ACC1 Rabbit mAb (AAA282770) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.)

WB (Western Blot)

(Western blot analysis of lysates from Mouse heart, using ACC1 Rabbit mAb (AAA282770) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)

product-image-AAA282770_WB13.jpg WB (Western Blot) (Western blot analysis of lysates from Mouse heart, using ACC1 Rabbit mAb (AAA282770) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)

WB (Western Blot)

(Western blot analysis of various lysates using ACC1 Rabbit mAb (AAA282770) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

product-image-AAA282770_WB15.jpg WB (Western Blot) (Western blot analysis of various lysates using ACC1 Rabbit mAb (AAA282770) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)
Related Product Information for anti-ACACA antibody
Acetyl-CoA carboxylase (ACC) is a complex multifunctional enzyme system. ACC is a biotin-containing enzyme which catalyzes the carboxylation of acetyl-CoA to malonyl-CoA, the rate-limiting step in fatty acid synthesis. There are two ACC forms, alpha and beta, encoded by two different genes. ACC-alpha is highly enriched in lipogenic tissues. The enzyme is under long term control at the transcriptional and translational levels and under short term regulation by the phosphorylation/dephosphorylation of targeted serine residues and by allosteric transformation by citrate or palmitoyl-CoA. Multiple alternatively spliced transcript variants divergent in the 5' sequence and encoding distinct isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
31
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated MW: 266kDa
Observed MW: 277kDa
UniProt Protein Name
Acetyl-CoA carboxylase 1
UniProt Gene Name
ACACA
UniProt Synonym Gene Names
ACAC; ACC1; ACCA; ACC1
UniProt Entry Name
ACACA_HUMAN

Similar Products

Product Notes

The ACACA acaca (Catalog #AAA282770) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ACC1 Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ACC1 can be used in a range of immunoassay formats including, but not limited to, ELISA, IP (Immunoprecipitation), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the ACACA acaca for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: RLAKQSRHLE VQILADQYGN AISLFGRDCS VQRRHQKIIE EAPATIATPA VFEHMEQCAV KLAKMVGYVS AGTVEYLYSQ DGSFYFLELN PRLQVEHPCT E. It is sometimes possible for the material contained within the vial of "ACC1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.