WB (Western Blot)
(Western blot analysis of extracts from rat testis tissue, using AKR1CL2 Mouse Monoclonal Antibody. The lane on the left was treated with blocking-peptides.)
Mouse AKR1CL2 Monoclonal Antibody | anti-AKR1CL2 antibody
AKR1CL2 Mouse Monoclonal Antibody
Reactivity
Human, Mouse, RatPrediction: Pig, Bovine, Horse, Sheep, Rabbit
Applications
Western Blot
Purity
Affinity-chromatography.
Synonyms
AKR1CL2, Antibody; AKR1CL2 Mouse Monoclonal Antibody; 1; 1,5-anhydro-D-fructose reductase; 5-anhydro-D-fructose reductase; AF reductase; AKCL2_HUMAN; AKR1CL2; Akr1e2; AKRDC1; Aldo keto reductase family 1 member C like protein 2; Aldo-keto reductase family 1 member C-like protein 2; Aldo-keto reductase family 1 member E2; HTSP; LoopADR; Testis specific protein; Testis-specific protein; anti-AKR1CL2 antibody
Host
Mouse
Reactivity
Human, Mouse, Rat
Prediction: Pig, Bovine, Horse, Sheep, Rabbit
Prediction: Pig, Bovine, Horse, Sheep, Rabbit
Clonality
Monoclonal
Isotype
Mouse IgG1
Specificity
AKR1CL2 Antibody detects endogenous levels of total AKR1CL2.
Purity/Purification
Affinity-chromatography.
Form/Format
Mouse IgG1 in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Sequence
MGDIPAVGLSSWKASPGKVTEAVKEAIDAGYRHFDCAYFYHNEREVGAGIRCKIKEGAVRREDLFIATKLWCTCHKKSLVETACRKSLKALKLNYLDLYLIHWPMGFKPPHPEWIMSCSELSFCLSHPRVQDLPLDESNMVIPSDTDFLDTWEAMEDLVITGLVKNIGVSNFNHEQLERLLNKPGLRFKPLTNQIECHPYLTQKNLISFCQSRDVSVTAYRPLGGSCEGVDLIDNPVIKRIAKEHGKSPAQILIRFQIQRNVIVIPGSITPSHIKENIQVFDFELTQHDMDNILSLNRNLRLAMFPITKNHKDYPFHIEY
Applicable Applications for anti-AKR1CL2 antibody
WB (Western Blot)
Immunogen
A synthesized peptide derived from human AKR1E2(Accession Q96JD6), corresponding to amino acid residues G162-K183.
Conjugation
Unconjugated
Expression
Specifically expressed in testis (PubMed:12604216, PubMed:15118078). Expressed in testicular germ cells and testis interstitial cells (PubMed:15118078).
Preparation and Storage
Store at -20 degree C. Stable for 12 months from date of receipt.
WB (Western Blot)
(Western blot analysis of extracts from rat testis tissue, using AKR1CL2 Mouse Monoclonal Antibody. The lane on the left was treated with blocking-peptides.)
WB (Western Blot)
(Western blot analysis of extracts from rat testis tissue, using AKR1CL2 Mouse Monoclonal Antibody. The lane on the left was treated with blocking-peptides.)
WB (Western Blot)
(Western blot analysis of extracts from various samples, using AKR1CL2 Mouse Monoclonal Antibody. Lane 1: RAW264.7 cells treated with blocking-peptides, Lane 2: RAW264.7 cells, Lane 3: mouse testis tissue, Lane 4: rat heart tissue, Lane 5: rat lung tissue.)
WB (Western Blot)
(Western blot analysis of extracts from various samples, using AKR1CL2 Mouse Monoclonal Antibody. Lane 1: RAW264.7 cells treated with blocking-peptides, Lane 2: RAW264.7 cells, Lane 3: mouse testis tissue, Lane 4: rat heart tissue, Lane 5: rat lung tissue.)
WB (Western Blot)
(Western blot analysis of extracts from mouse heart tissue, using AKR1CL2 Mouse Monoclonal Antibody. The lane on the left was treated with blocking-peptides.)
WB (Western Blot)
(Western blot analysis of extracts from mouse heart tissue, using AKR1CL2 Mouse Monoclonal Antibody. The lane on the left was treated with blocking-peptides.)
Product Categories/Family for anti-AKR1CL2 antibody
NCBI and Uniprot Product Information
Similar Products
Product Notes
The AKR1CL2 (Catalog #AAA330096) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The AKR1CL2 Mouse Monoclonal Antibody reacts with Human, Mouse, Rat Prediction: Pig, Bovine, Horse, Sheep, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's AKR1CL2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the AKR1CL2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MGDIPAVGLS SWKASPGKVT EAVKEAIDAG YRHFDCAYFY HNEREVGAGI RCKIKEGAVR REDLFIATKL WCTCHKKSLV ETACRKSLKA LKLNYLDLYL IHWPMGFKPP HPEWIMSCSE LSFCLSHPRV QDLPLDESNM VIPSDTDFLD TWEAMEDLVI TGLVKNIGVS NFNHEQLERL LNKPGLRFKP LTNQIECHPY LTQKNLISFC QSRDVSVTAY RPLGGSCEGV DLIDNPVIKR IAKEHGKSPA QILIRFQIQR NVIVIPGSIT PSHIKENIQV FDFELTQHDM DNILSLNRNL RLAMFPITKN HKDYPFHIEY. It is sometimes possible for the material contained within the vial of "AKR1CL2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.