Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282990_ICC8.jpg ICC (Immunocytochemistry) (Confocal imaging of MCF7 cells using [KO Validated] AKT1 Rabbit mAb (AAA282990,dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007,dilution 1:500)(Red).The cells were counterstained with ?-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green).DAPI was used for nuclear staining (Blue). Objective: 100x.)

Rabbit anti-Human AKT1 Monoclonal Antibody | anti-AKT1 antibody

[KO Validated] AKT1 Rabbit mAb

Average rating 0.0
No ratings yet
Reactivity
Human
Applications
ELISA, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
AKT1, Antibody; [KO Validated] AKT1 Rabbit mAb; AKT; PKB; RAC; PRKBA; PKB-ALPHA; RAC-ALPHA; T1; anti-AKT1 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
LSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKKLSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA
Applicable Applications for anti-AKT1 antibody
ELISA, ICC (Immunocytochemistry), IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot)
Cross Reactivity
Human, Mouse, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 380-480 of human AKT1 (NP_005154.2).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

ICC (Immunocytochemistry)

(Confocal imaging of MCF7 cells using [KO Validated] AKT1 Rabbit mAb (AAA282990,dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007,dilution 1:500)(Red).The cells were counterstained with ?-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green).DAPI was used for nuclear staining (Blue). Objective: 100x.)

product-image-AAA282990_ICC8.jpg ICC (Immunocytochemistry) (Confocal imaging of MCF7 cells using [KO Validated] AKT1 Rabbit mAb (AAA282990,dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007,dilution 1:500)(Red).The cells were counterstained with ?-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green).DAPI was used for nuclear staining (Blue). Objective: 100x.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Rat ovary using [KO Validated] AKT1 Rabbit mAb (AAA282990) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

product-image-AAA282990_IHC10.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Rat ovary using [KO Validated] AKT1 Rabbit mAb (AAA282990) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemisry)

(Immunohistochemistry analysis of paraffin-embedded Human breast cancer using [KO Validated] AKT1 Rabbit mAb (AAA282990) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

product-image-AAA282990_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry analysis of paraffin-embedded Human breast cancer using [KO Validated] AKT1 Rabbit mAb (AAA282990) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

WB (Western Blot)

(Western blot analysis of lysates from wild type(WT) and AKT1 knockout (KO) HeLa cells, using [KO Validated] AKT1 Rabbit mAb (AAA282990) at1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)

product-image-AAA282990_WB13.jpg WB (Western Blot) (Western blot analysis of lysates from wild type(WT) and AKT1 knockout (KO) HeLa cells, using [KO Validated] AKT1 Rabbit mAb (AAA282990) at1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)

WB (Western Blot)

(Western blot analysis of various lysates using [KO Validated] AKT1 Rabbit mAb (AAA282990) at1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)

product-image-AAA282990_WB15.jpg WB (Western Blot) (Western blot analysis of various lysates using [KO Validated] AKT1 Rabbit mAb (AAA282990) at1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)
Related Product Information for anti-AKT1 antibody
This gene encodes one of the three members of the human AKT serine-threonine protein kinase family which are often referred to as protein kinase B alpha, beta, and gamma. These highly similar AKT proteins all have an N-terminal pleckstrin homology domain, a serine/threonine-specific kinase domain and a C-terminal regulatory domain. These proteins are phosphorylated by phosphoinositide 3-kinase (PI3K). AKT/PI3K forms a key component of many signalling pathways that involve the binding of membrane-bound ligands such as receptor tyrosine kinases, G-protein coupled receptors, and integrin-linked kinase. These AKT proteins therefore regulate a wide variety of cellular functions including cell proliferation, survival, metabolism, and angiogenesis in both normal and malignant cells. AKT proteins are recruited to the cell membrane by phosphatidylinositol 3, 4, 5-trisphosphate (PIP3) after phosphorylation of phosphatidylinositol 4, 5-bisphosphate (PIP2) by PI3K. Subsequent phosphorylation of both threonine residue 308 and serine residue 473 is required for full activation of the AKT1 protein encoded by this gene. Phosphorylation of additional residues also occurs, for example, in response to insulin growth factor-1 and epidermal growth factor. Protein phosphatases act as negative regulators of AKT proteins by dephosphorylating AKT or PIP3. The PI3K/AKT signalling pathway is crucial for tumor cell survival. Survival factors can suppress apoptosis in a transcription-independent manner by activating AKT1 which then phosphorylates and inactivates components of the apoptotic machinery. AKT proteins also participate in the mammalian target of rapamycin (mTOR) signalling pathway which controls the assembly of the eukaryotic translation initiation factor 4F (eIF4E) complex and this pathway, in addition to responding to extracellular signals from growth factors and cytokines, is disregulated in many cancers. Mutations in this gene are associated with multiple types of cancer and excessive tissue growth including Proteus syndrome and Cowden syndrome 6, and breast, colorectal, and ovarian cancers. Multiple alternatively spliced transcript variants have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
207
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated MW: 56kDa
Observed MW: 60kDa
UniProt Protein Name
RAC-alpha serine/threonine-protein kinase
UniProt Gene Name
AKT1
UniProt Synonym Gene Names
PKB; RAC; PKB; PKB alpha
UniProt Entry Name
AKT1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The AKT1 akt1 (Catalog #AAA282990) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The [KO Validated] AKT1 Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's AKT1 can be used in a range of immunoassay formats including, but not limited to, ELISA, ICC (Immunocytochemistry), IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the AKT1 akt1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LSGLLKKDPK QRLGGGSEDA KEIMQHRFFA GIVWQHVYEK KLSPPFKPQV TSETDTRYFD EEFTAQMITI TPPDQDDSME CVDSERRPHF PQFSYSASGT A. It is sometimes possible for the material contained within the vial of "AKT1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.