Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA19667_IF11.jpg IF (Immunofluorescence) (Figure 11. IF analysis of AREB6/ZEB1 using anti-AREB6/ZEB1 antibody (AAA19667).AREB6/ZEB1 was detected in a paraffin-embedded section of human glioma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 5 ug/mL mouse anti-AREB6/ZEB1 Antibody (AAA19667) overnight at 4 degree C. Biotin conjugated goat anti-mouse IgG (BA1001) was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using DyLight550 Conjugated Avidin (BA1134). The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.)

Mouse AREB6/ZEB1 Monoclonal Antibody | anti-ZEB1 antibody

Anti-AREB6/ZEB1 Antibody Picoband (monoclonal, 8B12D7)

Gene Names
ZEB1; BZP; TCF8; AREB6; FECD6; NIL2A; PPCD3; ZFHEP; ZFHX1A; DELTAEF1
Reactivity
Human, Mouse, Rat
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Immunogen affinity purified.
Synonyms
AREB6/ZEB1, Antibody; Anti-AREB6/ZEB1 Antibody Picoband (monoclonal, 8B12D7); anti-ZEB1 antibody
Ordering
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
Mouse IgG2b
Clone Number
8B12D7
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.
Concentration
Adding 0.2 ml of distilled water will yield a concentration of 500 ug/ml. (varies by lot)
Applicable Applications for anti-ZEB1 antibody
IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot)
Application Notes
WB: 0.25-0.5 ug/ml, Human, Mouse, Rat
IHC-P: 2-5 ug/ml, Human, Mouse, Rat
IF: 5 ug/ml, Human
Tested Species: In-house tested species with positive results.
Enhanced Chemiluminescent Kit with anti-Mouse IgG for Western blot, and HRP Conjugated anti-Mouse IgG Super Vision Assay Kit for IHC(P).
Reconstitution
Adding 0.2 ml of distilled water will yield a concentration of 500 ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence of human AREB6/ZEB1 (LLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQ).
Preparation and Storage
Store at -20 degree C for one year from date of receipt. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for six months. Avoid repeated freezing and thawing.

IF (Immunofluorescence)

(Figure 11. IF analysis of AREB6/ZEB1 using anti-AREB6/ZEB1 antibody (AAA19667).AREB6/ZEB1 was detected in a paraffin-embedded section of human glioma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 5 ug/mL mouse anti-AREB6/ZEB1 Antibody (AAA19667) overnight at 4 degree C. Biotin conjugated goat anti-mouse IgG (BA1001) was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using DyLight550 Conjugated Avidin (BA1134). The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.)

product-image-AAA19667_IF11.jpg IF (Immunofluorescence) (Figure 11. IF analysis of AREB6/ZEB1 using anti-AREB6/ZEB1 antibody (AAA19667).AREB6/ZEB1 was detected in a paraffin-embedded section of human glioma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 5 ug/mL mouse anti-AREB6/ZEB1 Antibody (AAA19667) overnight at 4 degree C. Biotin conjugated goat anti-mouse IgG (BA1001) was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using DyLight550 Conjugated Avidin (BA1134). The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.)

IHC (Immunohistochemistry)

(Figure 10. IHC analysis of AREB6/ZEB1 using anti-AREB6/ZEB1 antibody (AAA19667).AREB6/ZEB1 was detected in a paraffin-embedded section of rat brain tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-AREB6/ZEB1 Antibody (AAA19667) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Mouse IgG Super Vision Assay Kit with DAB as the chromogen.)

product-image-AAA19667_IHC10.jpg IHC (Immunohistochemistry) (Figure 10. IHC analysis of AREB6/ZEB1 using anti-AREB6/ZEB1 antibody (AAA19667).AREB6/ZEB1 was detected in a paraffin-embedded section of rat brain tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-AREB6/ZEB1 Antibody (AAA19667) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Mouse IgG Super Vision Assay Kit with DAB as the chromogen.)

IHC (Immunohistchemistry)

(Figure 9. IHC analysis of AREB6/ZEB1 using anti-AREB6/ZEB1 antibody (AAA19667).AREB6/ZEB1 was detected in a paraffin-embedded section of mouse brain tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-AREB6/ZEB1 Antibody (AAA19667) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Mouse IgG Super Vision Assay Kit with DAB as the chromogen.)

product-image-AAA19667_IHC9.jpg IHC (Immunohistchemistry) (Figure 9. IHC analysis of AREB6/ZEB1 using anti-AREB6/ZEB1 antibody (AAA19667).AREB6/ZEB1 was detected in a paraffin-embedded section of mouse brain tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-AREB6/ZEB1 Antibody (AAA19667) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Mouse IgG Super Vision Assay Kit with DAB as the chromogen.)

IHC (Immunohistochemistry)

(Figure 8. IHC analysis of AREB6/ZEB1 using anti-AREB6/ZEB1 antibody (AAA19667).AREB6/ZEB1 was detected in a paraffin-embedded section of human testicular germ cell tumor tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-AREB6/ZEB1 Antibody (AAA19667) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Mouse IgG Super Vision Assay Kit with DAB as the chromogen.)

product-image-AAA19667_IHC8.jpg IHC (Immunohistochemistry) (Figure 8. IHC analysis of AREB6/ZEB1 using anti-AREB6/ZEB1 antibody (AAA19667).AREB6/ZEB1 was detected in a paraffin-embedded section of human testicular germ cell tumor tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-AREB6/ZEB1 Antibody (AAA19667) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Mouse IgG Super Vision Assay Kit with DAB as the chromogen.)

IHC (Immunohistochemistry)

(Figure 7. IHC analysis of AREB6/ZEB1 using anti-AREB6/ZEB1 antibody (AAA19667).AREB6/ZEB1 was detected in a paraffin-embedded section of human lung adenocarcinoma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-AREB6/ZEB1 Antibody (AAA19667) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Mouse IgG Super Vision Assay Kit with DAB as the chromogen.)

product-image-AAA19667_IHC7.jpg IHC (Immunohistochemistry) (Figure 7. IHC analysis of AREB6/ZEB1 using anti-AREB6/ZEB1 antibody (AAA19667).AREB6/ZEB1 was detected in a paraffin-embedded section of human lung adenocarcinoma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-AREB6/ZEB1 Antibody (AAA19667) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Mouse IgG Super Vision Assay Kit with DAB as the chromogen.)

IHC (Immunohistchemistry)

(Figure 6. IHC analysis of AREB6/ZEB1 using anti-AREB6/ZEB1 antibody (AAA19667).AREB6/ZEB1 was detected in a paraffin-embedded section of human laryngeal squamous cell carcinoma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-AREB6/ZEB1 Antibody (AAA19667) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Mouse IgG Super Vision Assay Kit with DAB as the chromogen.)

product-image-AAA19667_IHC6.jpg IHC (Immunohistchemistry) (Figure 6. IHC analysis of AREB6/ZEB1 using anti-AREB6/ZEB1 antibody (AAA19667).AREB6/ZEB1 was detected in a paraffin-embedded section of human laryngeal squamous cell carcinoma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-AREB6/ZEB1 Antibody (AAA19667) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Mouse IgG Super Vision Assay Kit with DAB as the chromogen.)

IHC (Immunohistochemistry)

(Figure 5. IHC analysis of AREB6/ZEB1 using anti-AREB6/ZEB1 antibody (AAA19667).AREB6/ZEB1 was detected in a paraffin-embedded section of human colorectal adenocarcinoma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-AREB6/ZEB1 Antibody (AAA19667) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Mouse IgG Super Vision Assay Kit with DAB as the chromogen.)

product-image-AAA19667_IHC5.jpg IHC (Immunohistochemistry) (Figure 5. IHC analysis of AREB6/ZEB1 using anti-AREB6/ZEB1 antibody (AAA19667).AREB6/ZEB1 was detected in a paraffin-embedded section of human colorectal adenocarcinoma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-AREB6/ZEB1 Antibody (AAA19667) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Mouse IgG Super Vision Assay Kit with DAB as the chromogen.)

IHC (Immunohistochemistry)

(Figure 4. IHC analysis of AREB6/ZEB1 using anti-AREB6/ZEB1 antibody (AAA19667).AREB6/ZEB1 was detected in a paraffin-embedded section of human breast cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-AREB6/ZEB1 Antibody (AAA19667) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Mouse IgG Super Vision Assay Kit with DAB as the chromogen.)

product-image-AAA19667_IHC4.jpg IHC (Immunohistochemistry) (Figure 4. IHC analysis of AREB6/ZEB1 using anti-AREB6/ZEB1 antibody (AAA19667).AREB6/ZEB1 was detected in a paraffin-embedded section of human breast cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-AREB6/ZEB1 Antibody (AAA19667) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Mouse IgG Super Vision Assay Kit with DAB as the chromogen.)

IHC (Immunohistochemistry)

(Figure 3. IHC analysis of AREB6/ZEB1 using anti-AREB6/ZEB1 antibody (AAA19667).AREB6/ZEB1 was detected in a paraffin-embedded section of human thyroid cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-AREB6/ZEB1 Antibody (AAA19667) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Mouse IgG Super Vision Assay Kit with DAB as the chromogen.)

product-image-AAA19667_IHC3.jpg IHC (Immunohistochemistry) (Figure 3. IHC analysis of AREB6/ZEB1 using anti-AREB6/ZEB1 antibody (AAA19667).AREB6/ZEB1 was detected in a paraffin-embedded section of human thyroid cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-AREB6/ZEB1 Antibody (AAA19667) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Mouse IgG Super Vision Assay Kit with DAB as the chromogen.)

IHC (Immunohistochemistry)

(Figure 2. IHC analysis of AREB6/ZEB1 using anti-AREB6/ZEB1 antibody (AAA19667).AREB6/ZEB1 was detected in a paraffin-embedded section of human glioblastoma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-AREB6/ZEB1 Antibody (AAA19667) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Mouse IgG Super Vision Assay Kit with DAB as the chromogen.)

product-image-AAA19667_IHC2.jpg IHC (Immunohistochemistry) (Figure 2. IHC analysis of AREB6/ZEB1 using anti-AREB6/ZEB1 antibody (AAA19667).AREB6/ZEB1 was detected in a paraffin-embedded section of human glioblastoma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-AREB6/ZEB1 Antibody (AAA19667) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Mouse IgG Super Vision Assay Kit with DAB as the chromogen.)

WB (Western Blot)

(Figure 1. Western blot analysis of AREB6/ZEB1 using anti-AREB6/ZEB1 antibody (AAA19667).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.Lane 1: human U87 whole cell lysates,Lane 2: rat brain tissue lysates,Lane 3: mouse brain tissue lysates,Lane 4: mouse lung tissue lysates.After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with mouse anti-AREB6/ZEB1 antigen affinity purified monoclonal antibody (#AAA19667) at 0.5 ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-mouse IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for AREB6/ZEB1 at approximately 200 kDa. The expected band size for AREB6/ZEB1 is at 124 kDa.)

product-image-AAA19667_WB.jpg WB (Western Blot) (Figure 1. Western blot analysis of AREB6/ZEB1 using anti-AREB6/ZEB1 antibody (AAA19667).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.Lane 1: human U87 whole cell lysates,Lane 2: rat brain tissue lysates,Lane 3: mouse brain tissue lysates,Lane 4: mouse lung tissue lysates.After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with mouse anti-AREB6/ZEB1 antigen affinity purified monoclonal antibody (#AAA19667) at 0.5 ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-mouse IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for AREB6/ZEB1 at approximately 200 kDa. The expected band size for AREB6/ZEB1 is at 124 kDa.)
Related Product Information for anti-ZEB1 antibody
ZEB1 (Zinc Finger E Box-Binding Homeobox 1), also called TCF8, NIL2A or DELTA-EF1, is a protein that in humans is encoded by the ZEB1 gene. Fluorescence in situ hybridization localized the ZEB1 gene to chromosome 10p11.2. Krafchak et al. (2005) demonstrated a complex (core plus secondary) binding site for TCF8 in the promoter of the COL4A3 gene, mutant in Alport syndrome and which encodes collagen type IV alpha-3. They detected expression of TCF8 in cornea. Nishimura et al. (2006) found that delta-Ef1 was upregulated during differentiation in a mouse smooth muscle cell (SMC) line.
Product Categories/Family for anti-ZEB1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
Predicted: 124 kDa

Observed: 130 kDa
NCBI Official Synonym Full Names
zinc finger E-box binding homeobox 1
NCBI Official Symbol
ZEB1
NCBI Official Synonym Symbols
BZP; TCF8; AREB6; FECD6; NIL2A; PPCD3; ZFHEP; ZFHX1A; DELTAEF1
NCBI Protein Information
zinc finger E-box-binding homeobox 1
UniProt Protein Name
Zinc finger E-box-binding homeobox 1
UniProt Gene Name
ZEB1
UniProt Synonym Gene Names
AREB6; TCF8; TCF-8
UniProt Entry Name
ZEB1_HUMAN

Similar Products

Product Notes

The ZEB1 zeb1 (Catalog #AAA19667) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Anti-AREB6/ZEB1 Antibody Picoband (monoclonal, 8B12D7) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's AREB6/ZEB1 can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot). WB: 0.25-0.5 ug/ml, Human, Mouse, Rat IHC-P: 2-5 ug/ml, Human, Mouse, Rat IF: 5 ug/ml, Human Tested Species: In-house tested species with positive results. Enhanced Chemiluminescent Kit with anti-Mouse IgG for Western blot, and HRP Conjugated anti-Mouse IgG Super Vision Assay Kit for IHC(P). Researchers should empirically determine the suitability of the ZEB1 zeb1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "AREB6/ZEB1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.