Mouse ASB10 Monoclonal Antibody | anti-ASB10 antibody

ASB10 (Ankyrin Repeat and SOCS Box Protein 10, ASB-10) (HRP)

Cat. Num. AAA25324

• Gene Names: ASB10; GLC1F
• Reactivity: Human, Mouse, Rat
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ASB10, Antibody; ASB10 (Ankyrin Repeat and SOCS Box Protein 10, ASB-10) (HRP); anti-ASB10 antibody

• Host: Mouse
• Reactivity: Human, Mouse, Rat
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1F3
• Specificity: Recognizes human ASB10. Species Crossreactivity: mouse and rat.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 467

• Applicable Applications for anti-ASB10 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant protein corresponding to aa48-153 from human ASB10 (NP_001135931) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MSWSPEECKGQGEPLDDRHPLCARLVEKPSRGSEEHLKSGPGPIVTRTASGPALAFWQAVLAGDVGCVSRILADSSTGLAPDSVFDTSDPERWRDFRFNIRALRLW
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(ASB10 monoclonal antibody. Western Blot analysis of ASB10 expression in NIH/3T3.)

Application Data

(Detection limit for recombinant GST tagged ASB10 is ~0.1ng/ml as a capture antibody.)

WB (Western Blot)

(ASB10 monoclonal antibody, Western Blot analysis of ASB10 expression in A-431.)

WB (Western Blot)

(ASB10 monoclonal antibody. Western Blot analysis of ASB10 expression in Raw 264.7.)

WB (Western Blot)

(ASB10 monoclonal antibody. Western Blot analysis of ASB10 expression in PC-12.)

WB (Western Blot)

(Western Blot detection against Immunogen (37.77kD).)

Product Categories/Family for anti-ASB10 antibody

Antibodies; SOCS

NCBI and Uniprot Product Information

• NCBI GI #: 294337037
• NCBI GeneID: 136371
• NCBI Accession #: NP_001135931
• NCBI GenBank Nucleotide #: NM_001142459
• UniProt Accession #: Q8WXI3
• NCBI Official Full Name: ankyrin repeat and SOCS box protein 10 isoform 1
• NCBI Official Synonym Full Names: ankyrin repeat and SOCS box containing 10
• NCBI Official Symbol: ASB10
• NCBI Official Synonym Symbols: GLC1F
• NCBI Protein Information: ankyrin repeat and SOCS box protein 10
• UniProt Protein Name: Ankyrin repeat and SOCS box protein 10
• UniProt Gene Name: ASB10
• UniProt Entry Name: ASB10_HUMAN