Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA24731_WB6.jpg WB (Western Blot) (ASB10 monoclonal antibody. Western Blot analysis of ASB10 expression in NIH/3T3.)

Mouse ASB10 Monoclonal Antibody | anti-ASB10 antibody

ASB10 (Ankyrin Repeat and SOCS Box Protein 10, ASB-10) (Biotin)

Average rating 0.0
No ratings yet
Gene Names
ASB10; GLC1F
Reactivity
Human, Mouse, Rat
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ASB10, Antibody; ASB10 (Ankyrin Repeat and SOCS Box Protein 10, ASB-10) (Biotin); anti-ASB10 antibody
Ordering
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1F3
Specificity
Recognizes human ASB10. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
467
Applicable Applications for anti-ASB10 antibody
ELISA, WB (Western Blot)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa48-153 from human ASB10 (NP_001135931) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSWSPEECKGQGEPLDDRHPLCARLVEKPSRGSEEHLKSGPGPIVTRTASGPALAFWQAVLAGDVGCVSRILADSSTGLAPDSVFDTSDPERWRDFRFNIRALRLW
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(ASB10 monoclonal antibody. Western Blot analysis of ASB10 expression in NIH/3T3.)

product-image-AAA24731_WB6.jpg WB (Western Blot) (ASB10 monoclonal antibody. Western Blot analysis of ASB10 expression in NIH/3T3.)

Application Data

(Detection limit for recombinant GST tagged ASB10 is ~0.1ng/ml as a capture antibody.)

product-image-AAA24731_APP5.jpg Application Data (Detection limit for recombinant GST tagged ASB10 is ~0.1ng/ml as a capture antibody.)

WB (Western Blot)

(ASB10 monoclonal antibody, Western Blot analysis of ASB10 expression in A-431.)

product-image-AAA24731_WB4.jpg WB (Western Blot) (ASB10 monoclonal antibody, Western Blot analysis of ASB10 expression in A-431.)

WB (Western Blot)

(ASB10 monoclonal antibody. Western Blot analysis of ASB10 expression in Raw 264.7.)

product-image-AAA24731_WB3.jpg WB (Western Blot) (ASB10 monoclonal antibody. Western Blot analysis of ASB10 expression in Raw 264.7.)

WB (Western Blot)

(ASB10 monoclonal antibody. Western Blot analysis of ASB10 expression in PC-12.)

product-image-AAA24731_WB2.jpg WB (Western Blot) (ASB10 monoclonal antibody. Western Blot analysis of ASB10 expression in PC-12.)

WB (Western Blot)

(Western Blot detection against Immunogen (37.77kD).)

product-image-AAA24731_WB.jpg WB (Western Blot) (Western Blot detection against Immunogen (37.77kD).)
Product Categories/Family for anti-ASB10 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
ankyrin repeat and SOCS box protein 10 isoform 1
NCBI Official Synonym Full Names
ankyrin repeat and SOCS box containing 10
NCBI Official Symbol
ASB10
NCBI Official Synonym Symbols
GLC1F
NCBI Protein Information
ankyrin repeat and SOCS box protein 10
UniProt Protein Name
Ankyrin repeat and SOCS box protein 10
UniProt Gene Name
ASB10
UniProt Entry Name
ASB10_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The ASB10 asb10 (Catalog #AAA24731) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ASB10 (Ankyrin Repeat and SOCS Box Protein 10, ASB-10) (Biotin) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ASB10 can be used in a range of immunoassay formats including, but not limited to, ELISA, WB (Western Blot). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ASB10 asb10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ASB10, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.