Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA28465_ICC6.jpg ICC (Immunocytochemistry) (Confocal imaging of paraffin-embedded Mouse brain tissue using ?III-Tubulin/?3-Tubulin Rabbit mAb (AAA28465, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01M citrate buffer (pH 6.0) prior to IF staining.)

Rabbit anti-Human betaIII-Tubulin Monoclonal Antibody | anti-TUBB3 antibody

betaIII-Tubulin Rabbit mAb

Reactivity
Human
Applications
Western Blot, Immunohistochemistry, Immunofluorescence, Immunocytochemistry, ELISA
Purity
Affinity purification
Synonyms
betaIII-Tubulin, Antibody; betaIII-Tubulin Rabbit mAb; CDCBM; FEOM3; TUBB4; CDCBM1; CFEOM3; beta-4; CFEOM3A; betaIII-Tubulin; anti-TUBB3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
VAVCDIPPRGLKMSSTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEGEMYEDDEEESEAQGPK
Applicable Applications for anti-TUBB3 antibody
Western Blot (WB), Immunohistochemistry-Paraffin (IHC-P), Immunofluorescence (IF), Immunocytochemistry (ICC), ELISA (EIA)
Application Notes
WB: 1:1000-1:2000
IHC-P: 1:200-1:4000
IF/ICC: 1:200-1:2000
ELISA: Recommended starting concentration is 1ug/mL.
Please optimize the concentration based on your specific assay requirements.
Cross Reactivity
Human, Mouse, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 351-450 of human betaIII-Tubulin (Q13509).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

ICC (Immunocytochemistry)

(Confocal imaging of paraffin-embedded Mouse brain tissue using ?III-Tubulin/?3-Tubulin Rabbit mAb (AAA28465, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01M citrate buffer (pH 6.0) prior to IF staining.)

product-image-AAA28465_ICC6.jpg ICC (Immunocytochemistry) (Confocal imaging of paraffin-embedded Mouse brain tissue using ?III-Tubulin/?3-Tubulin Rabbit mAb (AAA28465, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01M citrate buffer (pH 6.0) prior to IF staining.)

ICC (Immunocytochemistry)

(Confocal imaging of paraffin-embedded Rat brain tissue using ?III-Tubulin/?3-Tubulin Rabbit mAb (AAA28465, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01M citrate buffer (pH 6.0) prior to IF staining.)

product-image-AAA28465_ICC5.jpg ICC (Immunocytochemistry) (Confocal imaging of paraffin-embedded Rat brain tissue using ?III-Tubulin/?3-Tubulin Rabbit mAb (AAA28465, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01M citrate buffer (pH 6.0) prior to IF staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using ?III-Tubulin Rabbit mAb (AAA28465) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

product-image-AAA28465_IHC4.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using ?III-Tubulin Rabbit mAb (AAA28465) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using ?III-Tubulin Rabbit mAb (AAA28465) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

product-image-AAA28465_IHC3.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using ?III-Tubulin Rabbit mAb (AAA28465) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

ICC (Immunocytochemistry)

(Confocal imaging of SH-SY5Y cells using ?III-Tubulin Rabbit mAb (AAA28465, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with ?-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.)

product-image-AAA28465_ICC2.jpg ICC (Immunocytochemistry) (Confocal imaging of SH-SY5Y cells using ?III-Tubulin Rabbit mAb (AAA28465, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with ?-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.)

WB (Western Blot)

(Western blot analysis of various lysates using ?III-Tubulin Rabbit mAb (AAA28465) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 3min.)

product-image-AAA28465_WB.jpg WB (Western Blot) (Western blot analysis of various lysates using ?III-Tubulin Rabbit mAb (AAA28465) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 3min.)
Related Product Information for anti-TUBB3 antibody
This gene encodes a class III member of the beta tubulin protein family. Beta tubulins are one of two core protein families (alpha and beta tubulins) that heterodimerize and assemble to form microtubules. This protein is primarily expressed in neurons and may be involved in neurogenesis and axon guidance and maintenance. Mutations in this gene are the cause of congenital fibrosis of the extraocular muscles type 3. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 6.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated MW: 50kDa
Observed MW: 50kDa
UniProt Protein Name
Tubulin beta-3 chain
UniProt Gene Name
TUBB3
UniProt Synonym Gene Names
TUBB4
UniProt Entry Name
TBB3_HUMAN

Similar Products

Product Notes

The TUBB3 tubb3 (Catalog #AAA28465) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The betaIII-Tubulin Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's betaIII-Tubulin can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry-Paraffin (IHC-P), Immunofluorescence (IF), Immunocytochemistry (ICC), ELISA (EIA). WB: 1:1000-1:2000 IHC-P: 1:200-1:4000 IF/ICC: 1:200-1:2000 ELISA: Recommended starting concentration is 1ug/mL. Please optimize the concentration based on your specific assay requirements. Researchers should empirically determine the suitability of the TUBB3 tubb3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: VAVCDIPPRG LKMSSTFIGN STAIQELFKR ISEQFTAMFR RKAFLHWYTG EGMDEMEFTE AESNMNDLVS EYQQYQDATA EEEGEMYEDD EEESEAQGPK. It is sometimes possible for the material contained within the vial of "betaIII-Tubulin, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.