Loading...

Skip to main content
IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to CAND1 on HeLa cell. [antibody concentration 10 ug/ml])

Mouse CAND1 Monoclonal Antibody | anti-CAND1 antibody

CAND1 (Cullin-Associated and Neddylation-dissociated 1, DKFZp434M1414, FLJ10114, FLJ10929, FLJ38691, FLJ90441, KIAA0829, TIP120, TIP120A) (HRP)

Gene Names
CAND1; TIP120; TIP120A
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified
Synonyms
CAND1, Antibody; CAND1 (Cullin-Associated and Neddylation-dissociated 1, DKFZp434M1414, FLJ10114, FLJ10929, FLJ38691, FLJ90441, KIAA0829, TIP120, TIP120A) (HRP); Cullin-Associated and Neddylation-dissociated 1; DKFZp434M1414; FLJ10114; FLJ10929; FLJ38691; FLJ90441; KIAA0829; TIP120; TIP120A; anti-CAND1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG3,k
Clone Number
1G5
Specificity
Recognizes CAND1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-CAND1 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
CAND1 (NP_060918, 1aa-100aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MASASYHISNLLEKMTSSDKDFRFMATNDLMTELQKDSIKLDDDSERKVVKMILKLLEDKNGEVQNLAVKCLGPLVSKVKEYQVETIVDTLCTNMLSDKE
Conjugate
HRP
Preparation and Storage
May be stored at 4 degree C. For long-term storage, aliquot and store at 4 degree C. Do not freeze. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to CAND1 on HeLa cell. [antibody concentration 10 ug/ml])

IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to CAND1 on HeLa cell. [antibody concentration 10 ug/ml])

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to CAND1 on HeLa cell. [antibody concentration 10 ug/ml])

IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to CAND1 on HeLa cell. [antibody concentration 10 ug/ml])

WB (Western Blot)

(CAND1 monoclonal antibody (M05), clone 1G5. Western Blot analysis of CAND1 expression in Raw 264.7.)

WB (Western Blot) (CAND1 monoclonal antibody (M05), clone 1G5. Western Blot analysis of CAND1 expression in Raw 264.7.)

WB (Western Blot)

(CAND1 monoclonal antibody (M05), clone 1G5. Western Blot analysis of CAND1 expression in PC-12.)

WB (Western Blot) (CAND1 monoclonal antibody (M05), clone 1G5. Western Blot analysis of CAND1 expression in PC-12.)

WB (Western Blot)

(CAND1 monoclonal antibody (M05), clone 1G5. Western Blot analysis of CAND1 expression in NIH/3T3.)

WB (Western Blot) (CAND1 monoclonal antibody (M05), clone 1G5. Western Blot analysis of CAND1 expression in NIH/3T3.)

WB (Western Blot)

(CAND1 monoclonal antibody (M05), clone 1G5. Western Blot analysis of CAND1 expression in Hela S3 NE (Cat # L013V3).)

WB (Western Blot) (CAND1 monoclonal antibody (M05), clone 1G5. Western Blot analysis of CAND1 expression in Hela S3 NE (Cat # L013V3).)
Related Product Information for anti-CAND1 antibody
Mouse monoclonal antibody raised against a partial recombinant CAND1.
Product Categories/Family for anti-CAND1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
136kDa
NCBI Official Full Name
cullin-associated NEDD8-dissociated protein 1 isoform 1
NCBI Official Synonym Full Names
cullin associated and neddylation dissociated 1
NCBI Official Symbol
CAND1
NCBI Official Synonym Symbols
TIP120; TIP120A
NCBI Protein Information
cullin-associated NEDD8-dissociated protein 1
UniProt Protein Name
Cullin-associated NEDD8-dissociated protein 1
UniProt Gene Name
CAND1
UniProt Synonym Gene Names
KIAA0829; TIP120; TIP120A; TBP-interacting protein 120A

Similar Products

Product Notes

The CAND1 cand1 (Catalog #AAA26517) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's CAND1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CAND1 cand1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CAND1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.