Mouse anti-Human, Rat CAPNS1 Monoclonal Antibody | anti-CAPNS1 antibody

CAPNS1 (Calpain Small Subunit 1, CSS1, Calcium-activated Neutral Proteinase Small Subunit, CANP Small Subunit, Calcium-dependent Protease Small Subunit, CDPS, Calcium-dependent Protease Small Subunit 1, Calpain Regulatory Subunit, CAPN4, CAPNS) (Biotin)

Cat. Num. AAA24746

• Gene Names: CAPNS1; CANP; CDPS; CSS1; CANPS; CAPN4; CALPAIN4
• Reactivity: Human, Rat
• Applications: ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CAPNS1, Antibody; CAPNS1 (Calpain Small Subunit 1, CSS1, Calcium-activated Neutral Proteinase Small Subunit, CANP Small Subunit, Calcium-dependent Protease Small Subunit, CDPS, Calcium-dependent Protease Small Subunit 1, Calpain Regulatory Subunit, CAPN4, CAPNS) (Biotin); anti-CAPNS1 antibody

• Host: Mouse
• Reactivity: Human, Rat
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3C4
• Specificity: Recognizes human CAPNS1. Species Crossreactivity: rat.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-CAPNS1 antibody: ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: IF: 20ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa172-260 from human CAPNS1 (AAH00592) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: KRWQAIYKQFDTDRSGTICSSELPGAFEAAGFHLNEHLYNMIIRRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQE
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(CAPNS1 monoclonal antibody, Western Blot analysis of CAPNS1 expression in A-431.)

WB (Western Blot)

(Western blot analysis of CAPNS1 over-expressed 293 cell line, cotransfected with CAPNS1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with CAPNS1 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Application Data

(Detection limit for recombinant GST tagged CAPNS1 is ~0.1ng/ml when antibody 124328 was used as capture antibody.)

IF (Immunofluorescence)

(Immunofluorescence staining of CAPNS1 on HeLa cells using antibody 124328 at 20ug/ml.)

IHC (Immunohistochemistry)

(Immunoperoxidase staining of CAPNS1 on formalin-fixed paraffin-embedded human kidney using antibody 124328 at 3ug/ml.)

WB (Western Blot)

(Western Blot analysis of CAPNS1 expression in transfected 293T cell line using antibody 124328: Lane 1: CAPNS1 transfected lysate (28.3kD) Lane 2: Non-transfected lysate)

WB (Western Blot)

(Western Blot analysis of CAPNS1 expression in PC-12 cells using antibody 124328.)

Product Categories/Family for anti-CAPNS1 antibody

Antibodies; Calpain

References

1. Overexpression of a Minimal Domain of Calpastatin Suppresses IL-6 Production and Th17 Development via Reduced NF-kB and Increased STAT5 Signals. Iguchi-Hashimoto M, Usui T, Yoshifuji H, Shimizu M, Kobayashi S, Ito Y, Murakami K, Shiomi A, Yukawa N, Kawabata D, Nojima T, Ohmura K, Fujii T, Mimori T.PLoS One. 2011;6(10):e27020. Epub 2011 Oct 27. 2. The calpain inhibitor calpeptin prevents bleomycin-induced pulmonary fibrosis in mice. Tabata C, Tabata R, Nakano T.Clin Exp Immunol. 2010 Sep 15. doi: 10.1111/j.1365-2249.2010.04257.x. 3. Vitamin E and C supplementation does not ameliorate muscle dysfunction following anterior cruciate ligament surgery. Barker T, Leonard SW, Hansen J, Trawick RH, Ingram R, Burdett G, Lebold KM, Walker JA, Traber MG.Free Radic Biol Med. 2009 Sep 11.

NCBI and Uniprot Product Information

• NCBI GI #: 33875613
• NCBI GeneID: 826
• Molecular Weight: 28,316 Da
• NCBI Official Full Name: Homo sapiens calpain, small subunit 1, mRNA
• NCBI Official Synonym Full Names: calpain small subunit 1
• NCBI Official Symbol: CAPNS1
• NCBI Official Synonym Symbols: CANP; CDPS; CSS1; CANPS; CAPN4; CALPAIN4
• NCBI Protein Information: calpain small subunit 1