<
ICC (Immunocytochemistry)
(Confocal imaging of Neuro-2a cells using CD24 Rabbit PolymAb® (AAA283084, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x.)
Rabbit anti-Human, Mouse CD24 Monoclonal Antibody | anti-CD24 antibody
CD24 Rabbit PolymAb
Reactivity
Human, Mouse
Applications
ELISA, Immunocytochemistry, Immunofluorescence, Western Blot
Purity
Affinity purification
Synonyms
CD24, Antibody; CD24 Rabbit PolymAb; CD24A; anti-CD24 antibody
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
MGRAMVARLGLGLLLLALLLPTQIYSSETTTGTSSNSSQSTSNSGLAPNPTNATTKAAGGALQSTASLFVVSLSLLHLYS
Applicable Applications for anti-CD24 antibody
ELISA, ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot)
Immunogen
Recombinantfusion protein containing a sequence corresponding to amino acids 1-80 of human/mouse CD24. (NP_037362.1).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
ICC (Immunocytochemistry)
(Confocal imaging of Neuro-2a cells using CD24 Rabbit PolymAb® (AAA283084, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x.)
ICC (Immunocytochemistry)
(Confocal imaging of Neuro-2a cells using CD24 Rabbit PolymAb® (AAA283084, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x.)
ICC (Immunocytochemistry)
(Confocal imaging of paraffin-embedded Mouse spleen tissue using CD24 Rabbit PolymAb® (AAA283084, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IF staining. Objective: 40x.)
ICC (Immunocytochemistry)
(Confocal imaging of paraffin-embedded Mouse spleen tissue using CD24 Rabbit PolymAb® (AAA283084, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IF staining. Objective: 40x.)
ICC (Immunocytochemistry)
(Confocal imaging of MCF7 cells using CD24 Rabbit PolymAb® (AAA283084, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with ?-tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.)
ICC (Immunocytochemistry)
(Confocal imaging of MCF7 cells using CD24 Rabbit PolymAb® (AAA283084, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with ?-tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.)
WB (Western Blot)
(Western blot analysis of various lysates using CD24 Rabbit PolymAb® (AAA283084) at 1:5000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 60s.)
WB (Western Blot)
(Western blot analysis of various lysates using CD24 Rabbit PolymAb® (AAA283084) at 1:5000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 60s.)
Related Product Information for anti-CD24 antibody
This gene encodes a sialoglycoprotein that is expressed on mature granulocytes and B cells and modulates growth and differentiation signals to these cells. The precursor protein is cleaved to a short 32 amino acid mature peptide which is anchored via a glycosyl phosphatidylinositol (GPI) link to the cell surface. This gene was missing from previous genome assemblies, but is properly located on chromosome 6. Non-transcribed pseudogenes have been designated on chromosomes 1, 15, 20, and Y. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-CD24 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
Calculated MW: 8kDa/13kDa
Observed MW: 30-70kDa
Observed MW: 30-70kDa
UniProt Protein Name
Signal transducer CD24
UniProt Gene Name
CD24
UniProt Synonym Gene Names
CD24A
UniProt Entry Name
CD24_HUMAN
Similar Products
Product Notes
The CD24 cd24 (Catalog #AAA283084) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CD24 Rabbit PolymAb reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's CD24 can be used in a range of immunoassay formats including, but not limited to, ELISA, ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the CD24 cd24 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MGRAMVARLG LGLLLLALLL PTQIYSSETT TGTSSNSSQS TSNSGLAPNP TNATTKAAGG ALQSTASLFV VSLSLLHLYS. It is sometimes possible for the material contained within the vial of "CD24, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.