FCM/FACS (Flow Cytometry)
(Flow cytometry:1×10^6 Raji cells were stained with CD70 Rabbit mAb (AAA282852, 1 ug/ml Blue line) . Non-fluorescently stained Raji cells were used as blank control (red line).)
Rabbit anti-Human CD70 Monoclonal Antibody | anti-CD70 antibody
CD70 Rabbit mAb
Reactivity
Human
Applications
ELISA, Flow Cytometry, Functional Assay, Western Blot
Purity
Affinity purification
Synonyms
CD70, Antibody; CD70 Rabbit mAb; CD27L; LPFS3; CD27-L; CD27LG; TNFSF7; TNLG8A; CD70; anti-CD70 antibody
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
QRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
Applicable Applications for anti-CD70 antibody
ELISA, FCM/FACS (Flow Cytometry), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 39-193 of human CD70 (P32970).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
FCM/FACS (Flow Cytometry)
(Flow cytometry:1×10^6 Raji cells were stained with CD70 Rabbit mAb (AAA282852, 1 ug/ml Blue line) . Non-fluorescently stained Raji cells were used as blank control (red line).)
FCM/FACS (Flow Cytometry)
(Flow cytometry:1×10^6 Raji cells were stained with CD70 Rabbit mAb (AAA282852, 1 ug/ml Blue line) . Non-fluorescently stained Raji cells were used as blank control (red line).)
WB (Western Blot)
(Western blot analysis of various lysates using CD70 Rabbit mAb (AAA282852) at dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.)
WB (Western Blot)
(Western blot analysis of various lysates using CD70 Rabbit mAb (AAA282852) at dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.)
Related Product Information for anti-CD70 antibody
The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for TNFRSF27/CD27. It is a surface antigen on activated, but not on resting, T and B lymphocytes. It induces proliferation of costimulated T cells, enhances the generation of cytolytic T cells, and contributes to T cell activation. This cytokine is also reported to play a role in regulating B-cell activation, cytotoxic function of natural killer cells, and immunoglobulin sythesis.
Product Categories/Family for anti-CD70 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated MW: 21kDa
Observed MW: 21-27kDa
Observed MW: 21-27kDa
UniProt Protein Name
CD70 antigen
UniProt Gene Name
CD70
UniProt Synonym Gene Names
CD27L; CD27LG; TNFSF7; CD27-L
UniProt Entry Name
CD70_HUMAN
Similar Products
Product Notes
The CD70 cd70 (Catalog #AAA282852) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CD70 Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CD70 can be used in a range of immunoassay formats including, but not limited to, ELISA, FCM/FACS (Flow Cytometry), WB (Western Blot). Researchers should empirically determine the suitability of the CD70 cd70 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: QRFAQAQQQL PLESLGWDVA ELQLNHTGPQ QDPRLYWQGG PALGRSFLHG PELDKGQLRI HRDGIYMVHI QVTLAICSST TASRHHPTTL AVGICSPASR SISLLRLSFH QGCTIASQRL TPLARGDTLC TNLTGTLLPS RNTDETFFGV QWVRP. It is sometimes possible for the material contained within the vial of "CD70, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.