Mouse anti-Human CDK2 Monoclonal Antibody | anti-CDK2 antibody

CDK2 (Cell Division Protein Kinase 2, p33 Protein Kinase) (PE)

Cat. Num. AAA25641

• Gene Names: CDK2; CDKN2; p33(CDK2)
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CDK2, Antibody; CDK2 (Cell Division Protein Kinase 2, p33 Protein Kinase) (PE); anti-CDK2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2E8
• Specificity: Recognizes human CDK2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-CDK2 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa211-298 from human CDK2 (AAH03065) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: QLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

WB (Western Blot)

(CDK2 monoclonal antibody. Western Blot analysis of CDK2 expression in Jurkat.)

WB (Western Blot)

(Western blot analysis of CDK2 over-expressed 293 cell line, cotransfected with CDK2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with CDK2 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Application Data

(Detection limit for recombinant GST tagged CDK2 is ~0.03ng/ml as a capture antibody.)

WB (Western Blot)

(Western Blot analysis of CDK2 expression in transfected 293T cell line by CDK2 monoclonal antibody. Lane 1: CDK2 transfected lysate (33.9kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(CDK2 monoclonal antibody, Western Blot analysis of CDK2 expression in HL-60.)

WB (Western Blot)

(Western Blot detection against Immunogen (35.42kD).)

Related Product Information for anti-CDK2 antibody

CDK2 a serine/threonine protein kinase, is a member of a highly conserved family of protein kinases that regulate the eukaryotic cell cycle. The protein kinase is homologous to the gene products of S. cerevisiae cdc28, and S. pombe cdc2. For activity, it requires association with a cyclins which act as the positive regulatory subunit. It forms complex with cyclins A, E, D1, and D3. Cyclin E- CDK2 kinase is active in the G1 and S phases of the cell cycle and is important for the progression from G1 to S phase. The levels of Cyclin A- CDK2 are maximal at the G1/S transition and both CDK2 and Cyclin A associate with DNA in the initiation complex during replication.

Product Categories/Family for anti-CDK2 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 33869456
• NCBI GeneID: 1017
• Molecular Weight: 30,035 Da
• NCBI Official Full Name: Homo sapiens cyclin-dependent kinase 2, mRNA
• NCBI Official Synonym Full Names: cyclin dependent kinase 2
• NCBI Official Symbol: CDK2
• NCBI Official Synonym Symbols: CDKN2; p33(CDK2)
• NCBI Protein Information: cyclin-dependent kinase 2