Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA28563_IP9.jpg IP (Immunoprecipitation) (Immunoprecipitation of CDK4 from 300 µg extracts of HeLa cells was performed using 2 µg of [KO Validated] CDK4 Rabbit PolymAb® (AAA28563). Rabbit IgG isotype control (AC042) was used to precipitate the Control IgG sample. IP samples were eluted with 1X reducing Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using [KO Validated] CDK4 Rabbit PolymAb® (AAA28563) at a dilution of 1:3000.)

Rabbit anti-Human CDK4 Monoclonal Antibody | anti-CDK4 antibody

[KO Validated] CDK4 Rabbit PolymAb

Reactivity
Human
Applications
Western Blot, Immunohistochemistry, Immunofluorescence, Immunocytochemistry, Immunoprecipitation, ELISA
Purity
Affinity purification
Synonyms
CDK4, Antibody; [KO Validated] CDK4 Rabbit PolymAb; CMM3; PSK-J3; anti-CDK4 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
FAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE
Applicable Applications for anti-CDK4 antibody
WB (Western Blot), IHC (Immunohistochemistry), IF (Immunofluorescence), ICC (Immunocytochemistry), IP (Immunoprecipitation), ELISA
Application Notes
WB: 1:1000-1:12000
IHC-P: 1:200-1:800
IF/ICC: 1:200-1:800
IP: 0.5ug-4ug antibody for 200ug-400ug extracts of whole cells
ELISA: Recommended starting concentration is 1ug/mL.
Please optimize the concentration based on your specific assay requirements.
Cross Reactivity
Human, Mouse, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 204-303 of human CDK4 (NP_000066.1).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IP (Immunoprecipitation)

(Immunoprecipitation of CDK4 from 300 µg extracts of HeLa cells was performed using 2 µg of [KO Validated] CDK4 Rabbit PolymAb® (AAA28563). Rabbit IgG isotype control (AC042) was used to precipitate the Control IgG sample. IP samples were eluted with 1X reducing Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using [KO Validated] CDK4 Rabbit PolymAb® (AAA28563) at a dilution of 1:3000.)

product-image-AAA28563_IP9.jpg IP (Immunoprecipitation) (Immunoprecipitation of CDK4 from 300 µg extracts of HeLa cells was performed using 2 µg of [KO Validated] CDK4 Rabbit PolymAb® (AAA28563). Rabbit IgG isotype control (AC042) was used to precipitate the Control IgG sample. IP samples were eluted with 1X reducing Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using [KO Validated] CDK4 Rabbit PolymAb® (AAA28563) at a dilution of 1:3000.)

ICC (Immunocytochemistry)

(Confocal imaging of paraffin-embedded Rat lung tissue using [KO Validated] CDK4 Rabbit PolymAb® (A23521-PM, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.)

product-image-AAA28563_ICC8.jpg ICC (Immunocytochemistry) (Confocal imaging of paraffin-embedded Rat lung tissue using [KO Validated] CDK4 Rabbit PolymAb® (A23521-PM, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.)

ICC (Immunocytochemistry)

(Confocal imaging of HeLa cells using [KO Validated] CDK4 Rabbit PolymAb® (A23521-PM, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x.)

product-image-AAA28563_ICC7.jpg ICC (Immunocytochemistry) (Confocal imaging of HeLa cells using [KO Validated] CDK4 Rabbit PolymAb® (A23521-PM, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x.)

ICC (Immunocytochemistry)

(Confocal imaging of HeLa cells using [KO Validated] CDK4 Rabbit PolymAb® (A23521-PM, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with ?-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.)

product-image-AAA28563_ICC6.jpg ICC (Immunocytochemistry) (Confocal imaging of HeLa cells using [KO Validated] CDK4 Rabbit PolymAb® (A23521-PM, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with ?-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Rat spleen tissue using [KO Validated] CDK4 Rabbit PolymAb® (AAA28563) at a dilution of 1:600 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

product-image-AAA28563_IHC5.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Rat spleen tissue using [KO Validated] CDK4 Rabbit PolymAb® (AAA28563) at a dilution of 1:600 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human breast cancer tissue using [KO Validated] CDK4 Rabbit PolymAb® (AAA28563) at a dilution of 1:600 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

product-image-AAA28563_IHC4.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Human breast cancer tissue using [KO Validated] CDK4 Rabbit PolymAb® (AAA28563) at a dilution of 1:600 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using [KO Validated] CDK4 Rabbit PolymAb® (AAA28563) at a dilution of 1:600 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

product-image-AAA28563_IHC3.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using [KO Validated] CDK4 Rabbit PolymAb® (AAA28563) at a dilution of 1:600 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

WB (Western Blot)

(Western blot analysis of various lysates using [KO Validated] CDK4 Rabbit PolymAb® (AAA28563) at 1:1000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)

product-image-AAA28563_WB2.jpg WB (Western Blot) (Western blot analysis of various lysates using [KO Validated] CDK4 Rabbit PolymAb® (AAA28563) at 1:1000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)

WB (Western Blot)

(Western blot analysis of lysates from wild type (WT) and CDK4 knockout (KO) HeLa cells using [KO Validated] CDK4 Rabbit PolymAb® (AAA28563) at 1:3000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)

product-image-AAA28563_WB.jpg WB (Western Blot) (Western blot analysis of lysates from wild type (WT) and CDK4 knockout (KO) HeLa cells using [KO Validated] CDK4 Rabbit PolymAb® (AAA28563) at 1:3000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)
Related Product Information for anti-CDK4 antibody
The protein encoded by this gene is a member of the Ser/Thr protein kinase family. This protein is highly similar to the gene products of S. cerevisiae cdc28 and S. pombe cdc2. It is a catalytic subunit of the protein kinase complex that is important for cell cycle G1 phase progression. The activity of this kinase is restricted to the G1-S phase, which is controlled by the regulatory subunits D-type cyclins and CDK inhibitor p16(INK4a). This kinase was shown to be responsible for the phosphorylation of retinoblastoma gene product (Rb). Mutations in this gene as well as in its related proteins including D-type cyclins, p16(INK4a) and Rb were all found to be associated with tumorigenesis of a variety of cancers. Multiple polyadenylation sites of this gene have been reported.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated MW: 34kDa
Observed MW: 34kDa
UniProt Protein Name
Cyclin-dependent kinase 4
UniProt Gene Name
CDK4
UniProt Entry Name
CDK4_HUMAN

Similar Products

Product Notes

The CDK4 cdk4 (Catalog #AAA28563) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The [KO Validated] CDK4 Rabbit PolymAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CDK4 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry), IF (Immunofluorescence), ICC (Immunocytochemistry), IP (Immunoprecipitation), ELISA. WB: 1:1000-1:12000 IHC-P: 1:200-1:800 IF/ICC: 1:200-1:800 IP: 0.5ug-4ug antibody for 200ug-400ug extracts of whole cells ELISA: Recommended starting concentration is 1ug/mL. Please optimize the concentration based on your specific assay requirements. Researchers should empirically determine the suitability of the CDK4 cdk4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: FAEMFRRKPL FCGNSEADQL GKIFDLIGLP PEDDWPRDVS LPRGAFPPRG PRPVQSVVPE MEESGAQLLL EMLTFNPHKR ISAFRALQHS YLHKDEGNPE. It is sometimes possible for the material contained within the vial of "CDK4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.