Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA25650_WB7.jpg WB (Western Blot) (CNOT7 monoclonal antibody, Western Blot analysis of CNOT7 expression in HeLa.)

Mouse CNOT7 Monoclonal Antibody | anti-CNOT7 antibody

CNOT7 (CCR4-NOT Transcription Complex Subunit 7, BTG1-binding Factor 1, CCR4-associated Factor 1, CAF-1, CAF1) (PE)

Gene Names
CNOT7; CAF1; CAF-1; Caf1a; hCAF-1
Reactivity
Human, Mouse, Rat
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CNOT7, Antibody; CNOT7 (CCR4-NOT Transcription Complex Subunit 7, BTG1-binding Factor 1, CCR4-associated Factor 1, CAF-1, CAF1) (PE); anti-CNOT7 antibody
Ordering
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG
Clone Number
2F6
Specificity
Recognizes human CNOT7. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-CNOT7 antibody
ELISA, IF (Immunofluorescence), WB (Western Blot)
Application Notes
IF: 40ug/ml
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-286 from human CNOT7 (AAH60852) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MPAATVDHSQRICEVWACNLDEEMKKIRQVIRKYNYVAMDTEFPGVVARPIGEFRSNADYQYQLLRCNVDLLKIIQLGLTFMNEQGEYPPGTSTWQFNFKFNLTEDMYAQDSIELLTTSGIQFKKHEEEGIETQYFAELLMTSGVVLCEGVKWLSFHSGYDFGYLIKILTNSNLPEEELDFFEILRLFFPVIYDVKYLMKSCKNLKGGLQEVAEQLELERIGPQHQAGSDSLLTGMAFFKMREMFFEDHIDDAKYCGHLYGLGSGSSYVQNGTGNAYEEEANKQS
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

WB (Western Blot)

(CNOT7 monoclonal antibody, Western Blot analysis of CNOT7 expression in HeLa.)

product-image-AAA25650_WB7.jpg WB (Western Blot) (CNOT7 monoclonal antibody, Western Blot analysis of CNOT7 expression in HeLa.)

WB (Western Blot)

(CNOT7 monoclonal antibody. Western Blot analysis of CNOT7 expression in PC-12.)

product-image-AAA25650_WB6.jpg WB (Western Blot) (CNOT7 monoclonal antibody. Western Blot analysis of CNOT7 expression in PC-12.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to CNOT7 on HeLa cell. [antibody concentration 40ug/ml].)

product-image-AAA25650_IF5.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to CNOT7 on HeLa cell. [antibody concentration 40ug/ml].)

WB (Western Blot)

(CNOT7 monoclonal antibody. Western Blot analysis of CNOT7 expression in NIH/3T3.)

product-image-AAA25650_WB4.jpg WB (Western Blot) (CNOT7 monoclonal antibody. Western Blot analysis of CNOT7 expression in NIH/3T3.)

WB (Western Blot)

(CNOT7 monoclonal antibody. Western Blot analysis of CNOT7 expression in Raw 264.7.)

product-image-AAA25650_WB3.jpg WB (Western Blot) (CNOT7 monoclonal antibody. Western Blot analysis of CNOT7 expression in Raw 264.7.)

WB (Western Blot)

(CNOT7 monoclonal antibody. Western Blot analysis of CNOT7 expression in Hela NE.)

product-image-AAA25650_WB2.jpg WB (Western Blot) (CNOT7 monoclonal antibody. Western Blot analysis of CNOT7 expression in Hela NE.)

WB (Western Blot)

(Western Blot detection against Immunogen (57.46kD).)

product-image-AAA25650_WB.jpg WB (Western Blot) (Western Blot detection against Immunogen (57.46kD).)
Product Categories/Family for anti-CNOT7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
28,228 Da
NCBI Official Full Name
Homo sapiens CCR4-NOT transcription complex, subunit 7, mRNA
NCBI Official Synonym Full Names
CCR4-NOT transcription complex subunit 7
NCBI Official Symbol
CNOT7
NCBI Official Synonym Symbols
CAF1; CAF-1; Caf1a; hCAF-1
NCBI Protein Information
CCR4-NOT transcription complex subunit 7

Similar Products

Product Notes

The CNOT7 (Catalog #AAA25650) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CNOT7 (CCR4-NOT Transcription Complex Subunit 7, BTG1-binding Factor 1, CCR4-associated Factor 1, CAF-1, CAF1) (PE) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CNOT7 can be used in a range of immunoassay formats including, but not limited to, ELISA, IF (Immunofluorescence), WB (Western Blot). IF: 40ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CNOT7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CNOT7, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.