Rabbit anti-Human CTCF Monoclonal Antibody | anti-CTCF antibody

CTCF Rabbit mAb

Cat. Num. AAA28513

• Reactivity: Human
• Applications: Western Blot, Immunofluorescence, Immunocytochemistry, Immunoprecipitation, ELISA, Chromatin Immunoprecipitation, Immunoprecipitation, Chromatin Immunoprecipitation, Immunoprecipitation
• Purity: Affinity purification
• Synonyms: CTCF, Antibody; CTCF Rabbit mAb; MRD21; FAP108; CFAP108; CTCF; anti-CTCF antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG
• Purity/Purification: Affinity purification
• Form/Format: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
• Sequence: PAVEIEPEPEPQPVTPAPPPAKKRRGRPPGRTNQPKQNQPTAIIQVEDQNTGAIENIIVEVKKEPDAEPAEGEEEEAQPAATDAPNGDLTPEMILSMMDR

• Applicable Applications for anti-CTCF antibody: Western Blot (WB), Immunofluorescence (IF), Immunocytochemistry (ICC), Immunoprecipitation (IP), ELISA (EIA), Chromatin Immunoprecipitation (ChIP), Chromatin Immunoprecipitation (ChIP)-seq, CUT&Tag
• Application Notes: WB: 1:1000-1:4000; IF/ICC: 1:200-1:800; IP: 0.5ug-4ug antibody for 200ug-400ug extracts of whole cells; ELISA: Recommended starting concentration is 1ug/mL.; Please optimize the concentration based on your specific assay requirements.; ChIP: 3ug antibody for 10ug-15ug of Chromatin; ChIP-seq: 1:50-1:100; CUT&Tag: 10? cells /2 ug
• Cross Reactivity: Human, Mouse, Rat
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 628-727 of human CTCF (P49711).
• Preparation and Storage: Store at -20 degree C. Avoid freeze/thaw cycles.

ChIP (Chromatin Immunoprecipitation)

(Chromatin immunoprecipitation analysis of extracts of 293T cells, using CTCF antibody (AAA28513) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.)

IP (Immunoprecipitation)

(Immunoprecipitation analysis of 300 ug extracts of 293T cells using 3 ug CTCF antibody (AAA28513). Western blot was performed from the immunoprecipitate using CTCF antibody (AAA28513) at a dilution of 1:1000.)

ICC (Immunocytochemistry)

(Confocal imaging of U-2 OS cells using CTCF Rabbit mAb (AAA28513, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with ?-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.)

WB (Western Blot)

(Western blot analysis of various lysates using CTCF Rabbit mAb (AAA28513) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)

ChIP (Chromatin Immunoprecipitation)

(Chromatin immunoprecipitations were performed with cross-linked chromatin from 293T cells and CTCF Rabbit mAb (AAA28513). The ChIP sequencing results indicate the enrichment pattern of CTCF in selected genomic region and representative gene loci (MYC), as shown in figure.)

Application Data

(CUT&Tag was performed using the CUT&Tag Assay Kit (pAG-Tn5) for Illumina (RK20265) from 10⁵ K562 cells with 2 ug CTCF Rabbit mAb?along with a Goat Anti-Rabbit IgG(H+L). The CUT&Tag results indicate the enrichment pattern of CTCF in representative gene loci (MYC), as shown in figure.)

Related Product Information for anti-CTCF antibody

This gene is a member of the BORIS + CTCF gene family and encodes a transcriptional regulator protein with 11 highly conserved zinc finger (ZF) domains. This nuclear protein is able to use different combinations of the ZF domains to bind different DNA target sequences and proteins. Depending upon the context of the site, the protein can bind a histone acetyltransferase (HAT)-containing complex and function as a transcriptional activator or bind a histone deacetylase (HDAC)-containing complex and function as a transcriptional repressor. If the protein is bound to a transcriptional insulator element, it can block communication between enhancers and upstream promoters, thereby regulating imprinted expression. Mutations in this gene have been associated with invasive breast cancers, prostate cancers, and Wilms' tumors. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Product Categories/Family for anti-CTCF antibody

Epigenetics Nuclear Signaling; Antibodies

NCBI and Uniprot Product Information

• NCBI GI #: 1706179
• NCBI GeneID: 10664
• UniProt Accession #: P49711; Q53XI7; Q59EL8; B5MC38
• Molecular Weight: Calculated MW: 83kDa; Observed MW: 140kDa
• UniProt Protein Name: Transcriptional repressor CTCF
• UniProt Gene Name: CTCF
• UniProt Entry Name: CTCF_HUMAN