Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA28513_ChIP6.jpg ChIP (Chromatin Immunoprecipitation) (Chromatin immunoprecipitation analysis of extracts of 293T cells, using CTCF antibody (AAA28513) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.)

Rabbit anti-Human CTCF Monoclonal Antibody | anti-CTCF antibody

CTCF Rabbit mAb

Reactivity
Human
Applications
Western Blot, Immunofluorescence, Immunocytochemistry, Immunoprecipitation, ELISA, Chromatin Immunoprecipitation, Immunoprecipitation, Chromatin Immunoprecipitation, Immunoprecipitation
Purity
Affinity purification
Synonyms
CTCF, Antibody; CTCF Rabbit mAb; MRD21; FAP108; CFAP108; CTCF; anti-CTCF antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
PAVEIEPEPEPQPVTPAPPPAKKRRGRPPGRTNQPKQNQPTAIIQVEDQNTGAIENIIVEVKKEPDAEPAEGEEEEAQPAATDAPNGDLTPEMILSMMDR
Applicable Applications for anti-CTCF antibody
WB (Western Blot), IF (Immunofluorescence), ICC (Immunocytochemistry), IP (Immunoprecipitation), ELISA, ChIP (Chromatin Immunoprecipitation), ChIP (Chromatin Immunoprecipitation)
Application Notes
WB: 1:1000-1:4000
IF/ICC: 1:200-1:800
IP: 0.5ug-4ug antibody for 200ug-400ug extracts of whole cells
ELISA: Recommended starting concentration is 1ug/mL.
Please optimize the concentration based on your specific assay requirements.
ChIP: 3ug antibody for 10ug-15ug of Chromatin
ChIP-seq: 1:50-1:100
CUT&Tag: 10? cells /2 ug
Cross Reactivity
Human, Mouse, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 628-727 of human CTCF (P49711).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

ChIP (Chromatin Immunoprecipitation)

(Chromatin immunoprecipitation analysis of extracts of 293T cells, using CTCF antibody (AAA28513) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.)

product-image-AAA28513_ChIP6.jpg ChIP (Chromatin Immunoprecipitation) (Chromatin immunoprecipitation analysis of extracts of 293T cells, using CTCF antibody (AAA28513) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.)

IP (Immunoprecipitation)

(Immunoprecipitation analysis of 300 ug extracts of 293T cells using 3 ug CTCF antibody (AAA28513). Western blot was performed from the immunoprecipitate using CTCF antibody (AAA28513) at a dilution of 1:1000.)

product-image-AAA28513_IP5.jpg IP (Immunoprecipitation) (Immunoprecipitation analysis of 300 ug extracts of 293T cells using 3 ug CTCF antibody (AAA28513). Western blot was performed from the immunoprecipitate using CTCF antibody (AAA28513) at a dilution of 1:1000.)

ICC (Immunocytochemistry)

(Confocal imaging of U-2 OS cells using CTCF Rabbit mAb (AAA28513, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with ?-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.)

product-image-AAA28513_ICC4.jpg ICC (Immunocytochemistry) (Confocal imaging of U-2 OS cells using CTCF Rabbit mAb (AAA28513, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with ?-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.)

WB (Western Blot)

(Western blot analysis of various lysates using CTCF Rabbit mAb (AAA28513) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)

product-image-AAA28513_WB3.jpg WB (Western Blot) (Western blot analysis of various lysates using CTCF Rabbit mAb (AAA28513) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)

ChIP (Chromatin Immunoprecipitation)

(Chromatin immunoprecipitations were performed with cross-linked chromatin from 293T cells and CTCF Rabbit mAb (AAA28513). The ChIP sequencing results indicate the enrichment pattern of CTCF in selected genomic region and representative gene loci (MYC), as shown in figure.)

product-image-AAA28513_ChIP2.jpg ChIP (Chromatin Immunoprecipitation) (Chromatin immunoprecipitations were performed with cross-linked chromatin from 293T cells and CTCF Rabbit mAb (AAA28513). The ChIP sequencing results indicate the enrichment pattern of CTCF in selected genomic region and representative gene loci (MYC), as shown in figure.)

Application Data

(CUT&Tag was performed using the CUT&Tag Assay Kit (pAG-Tn5) for Illumina (RK20265) from 10<sup>5</sup> K562 cells with 2 ug CTCF Rabbit mAb?along with a Goat Anti-Rabbit IgG(H+L). The CUT&Tag results indicate the enrichment pattern of CTCF in representative gene loci (MYC), as shown in figure.)

product-image-AAA28513_APP.jpg Application Data (CUT&Tag was performed using the CUT&Tag Assay Kit (pAG-Tn5) for Illumina (RK20265) from 10<sup>5</sup> K562 cells with 2 ug CTCF Rabbit mAb?along with a Goat Anti-Rabbit IgG(H+L). The CUT&Tag results indicate the enrichment pattern of CTCF in representative gene loci (MYC), as shown in figure.)
Related Product Information for anti-CTCF antibody
This gene is a member of the BORIS + CTCF gene family and encodes a transcriptional regulator protein with 11 highly conserved zinc finger (ZF) domains. This nuclear protein is able to use different combinations of the ZF domains to bind different DNA target sequences and proteins. Depending upon the context of the site, the protein can bind a histone acetyltransferase (HAT)-containing complex and function as a transcriptional activator or bind a histone deacetylase (HDAC)-containing complex and function as a transcriptional repressor. If the protein is bound to a transcriptional insulator element, it can block communication between enhancers and upstream promoters, thereby regulating imprinted expression. Mutations in this gene have been associated with invasive breast cancers, prostate cancers, and Wilms' tumors. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-CTCF antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
Calculated MW: 83kDa
Observed MW: 140kDa
UniProt Protein Name
Transcriptional repressor CTCF
UniProt Gene Name
CTCF
UniProt Entry Name
CTCF_HUMAN

Similar Products

Product Notes

The CTCF ctcf (Catalog #AAA28513) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CTCF Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CTCF can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IF (Immunofluorescence), ICC (Immunocytochemistry), IP (Immunoprecipitation), ELISA, ChIP (Chromatin Immunoprecipitation), ChIP (Chromatin Immunoprecipitation). WB: 1:1000-1:4000 IF/ICC: 1:200-1:800 IP: 0.5ug-4ug antibody for 200ug-400ug extracts of whole cells ELISA: Recommended starting concentration is 1ug/mL. Please optimize the concentration based on your specific assay requirements. ChIP: 3ug antibody for 10ug-15ug of Chromatin ChIP-seq: 1:50-1:100 CUT&Tag: 10? cells /2 ug. Researchers should empirically determine the suitability of the CTCF ctcf for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: PAVEIEPEPE PQPVTPAPPP AKKRRGRPPG RTNQPKQNQP TAIIQVEDQN TGAIENIIVE VKKEPDAEPA EGEEEEAQPA ATDAPNGDLT PEMILSMMDR. It is sometimes possible for the material contained within the vial of "CTCF, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.