Rabbit anti-Human Cytokeratin 14 (KRT14) Monoclonal Antibody | anti-KRT14 antibody

Cytokeratin 14 (KRT14) Rabbit mAb

Cat. Num. AAA28471

• Reactivity: Human
• Applications: Western Blot, Immunohistochemistry, ELISA
• Purity: Affinity purification
• Synonyms: Cytokeratin 14 (KRT14), Antibody; Cytokeratin 14 (KRT14) Rabbit mAb; K14; NFJ; CK14; EBS1; EBS3; EBS4; EBS1A; EBS1B; EBS1C; EBS1D; Cytokeratin 14 (KRT14); anti-KRT14 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG
• Purity/Purification: Affinity purification
• Form/Format: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
• Sequence: VGGDVNVEMDAAPGVDLSRILNEMRDQYEKMAEKNRKDAEEWFFTKTEELNREVATNSELVQSGKSEISELRRTMQNLEIELQSQLSMKASLENSLEETKGRYCMQLAQIQEMIGSVEEQLAQLRCEMEQQNQEYKILLDVKTRLEQEIATYRRLLEGEDAHLSSSQFSSGSQSSRDVTSSSRQIRTKVMDVHD

• Applicable Applications for anti-KRT14 antibody: Western Blot (WB), Immunohistochemistry-Paraffin (IHC-P), ELISA (EIA)
• Application Notes: WB: 1:1000-1:2000; IHC-P: 1:200-1:800; ELISA: Recommended starting concentration is 1ug/mL.; Please optimize the concentration based on your specific assay requirements.
• Cross Reactivity: Human, Mouse, Rat
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 264-457 of human Cytokeratin 14 (KRT14)(P02533).
• Preparation and Storage: Store at -20 degree C. Avoid freeze/thaw cycles.

IHC (Immunohistchemistry)

(Immunohistochemistry analysis of paraffin-embedded Rat brain using Cytokeratin 14 (KRT14) Rabbit mAb (AAA28471) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Rat brain using Cytokeratin 14 (KRT14) Rabbit mAb (AAA28471) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human tonsil using Cytokeratin 14 (KRT14) Rabbit mAb (AAA28471) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human lung squamous carcinoma tissue using Cytokeratin 14 (KRT14) Rabbit mAb (AAA28471) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human cervical squamous cell carcinoma using Cytokeratin 14 (KRT14) Rabbit mAb (AAA28471) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

WB (Western Blot)

(Western blot analysis of lysates from SK-OV-3 cells, using Cytokeratin 14 (KRT14) Rabbit mAb (AAA28471) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3min.)

Related Product Information for anti-KRT14 antibody

This gene encodes a member of the keratin family, the most diverse group of intermediate filaments. This gene product, a type I keratin, is usually found as a heterotetramer with two keratin 5 molecules, a type II keratin. Together they form the cytoskeleton of epithelial cells. Mutations in the genes for these keratins are associated with epidermolysis bullosa simplex. At least one pseudogene has been identified at 17p12-p11.

Product Categories/Family for anti-KRT14 antibody

Signal Transduction; Cell Biology Developmental Biology; Cytoskeleton; Intermediate Filaments; Extracellular Matrix; Keratin; Antibodies

NCBI and Uniprot Product Information

• NCBI GI #: 229463044
• NCBI GeneID: 3861
• UniProt Accession #: P02533; Q14715; Q53XY3; Q9BUE3; Q9UBN2; Q9UBN3; Q9UCY4
• Molecular Weight: Calculated MW: 52kDa; Observed MW: 53kDa
• UniProt Protein Name: Keratin, type I cytoskeletal 14
• UniProt Gene Name: KRT14
• UniProt Synonym Gene Names: CK-14; K14
• UniProt Entry Name: K1C14_HUMAN