Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

Rabbit anti-Human Cytokeratin 14 (KRT14) Monoclonal Antibody | anti-KRT14 antibody

Cytokeratin 14 (KRT14) Rabbit mAb

Reactivity
Human
Applications
Western Blot, Immunohistochemistry, ELISA
Purity
Affinity purification
Synonyms
Cytokeratin 14 (KRT14), Antibody; Cytokeratin 14 (KRT14) Rabbit mAb; K14; NFJ; CK14; EBS1; EBS3; EBS4; EBS1A; EBS1B; EBS1C; EBS1D; Cytokeratin 14 (KRT14); anti-KRT14 antibody
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
VGGDVNVEMDAAPGVDLSRILNEMRDQYEKMAEKNRKDAEEWFFTKTEELNREVATNSELVQSGKSEISELRRTMQNLEIELQSQLSMKASLENSLEETKGRYCMQLAQIQEMIGSVEEQLAQLRCEMEQQNQEYKILLDVKTRLEQEIATYRRLLEGEDAHLSSSQFSSGSQSSRDVTSSSRQIRTKVMDVHD
Applicable Applications for anti-KRT14 antibody
Western Blot (WB), Immunohistochemistry-Paraffin (IHC-P), ELISA (EIA)
Application Notes
WB: 1:1000-1:2000
IHC-P: 1:200-1:800
ELISA: Recommended starting concentration is 1ug/mL.
Please optimize the concentration based on your specific assay requirements.
Cross Reactivity
Human, Mouse, Rat
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 264-457 of human Cytokeratin 14 (KRT14)(P02533).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IHC (Immunohistchemistry)

(Immunohistochemistry analysis of paraffin-embedded Rat brain using Cytokeratin 14 (KRT14) Rabbit mAb (AAA28471) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Rat brain using Cytokeratin 14 (KRT14) Rabbit mAb (AAA28471) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human tonsil using Cytokeratin 14 (KRT14) Rabbit mAb (AAA28471) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human lung squamous carcinoma tissue using Cytokeratin 14 (KRT14) Rabbit mAb (AAA28471) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human cervical squamous cell carcinoma using Cytokeratin 14 (KRT14) Rabbit mAb (AAA28471) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

WB (Western Blot)

(Western blot analysis of lysates from SK-OV-3 cells, using Cytokeratin 14 (KRT14) Rabbit mAb (AAA28471) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3min.)

Related Product Information for anti-KRT14 antibody
This gene encodes a member of the keratin family, the most diverse group of intermediate filaments. This gene product, a type I keratin, is usually found as a heterotetramer with two keratin 5 molecules, a type II keratin. Together they form the cytoskeleton of epithelial cells. Mutations in the genes for these keratins are associated with epidermolysis bullosa simplex. At least one pseudogene has been identified at 17p12-p11.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
Calculated MW: 52kDa
Observed MW: 53kDa
UniProt Protein Name
Keratin, type I cytoskeletal 14
UniProt Gene Name
KRT14
UniProt Synonym Gene Names
CK-14; K14
UniProt Entry Name
K1C14_HUMAN

Similar Products

Product Notes

The KRT14 krt14 (Catalog #AAA28471) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Cytokeratin 14 (KRT14) Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Cytokeratin 14 (KRT14) can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry-Paraffin (IHC-P), ELISA (EIA). WB: 1:1000-1:2000 IHC-P: 1:200-1:800 ELISA: Recommended starting concentration is 1ug/mL. Please optimize the concentration based on your specific assay requirements. Researchers should empirically determine the suitability of the KRT14 krt14 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: VGGDVNVEMD AAPGVDLSRI LNEMRDQYEK MAEKNRKDAE EWFFTKTEEL NREVATNSEL VQSGKSEISE LRRTMQNLEI ELQSQLSMKA SLENSLEETK GRYCMQLAQI QEMIGSVEEQ LAQLRCEMEQ QNQEYKILLD VKTRLEQEIA TYRRLLEGED AHLSSSQFSS GSQSSRDVTS SSRQIRTKVM DVHD. It is sometimes possible for the material contained within the vial of "Cytokeratin 14 (KRT14), Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.