IP (Immunoprecipitation)
(Immunoprecipitation of DNMT1 from 300 ug extracts of Jurkat cells was performed using 3 ug of DNMT1 Rabbit mAb (AAA282786). Rabbit IgG isotype control (AC042) was used to precipitate the Control IgG sample. IP samples were eluted with 1X reducing Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using DNMT1 Rabbit mAb (AAA282786) at a dilution of 1:1000.)
Rabbit anti-Human DNMT1 Monoclonal Antibody | anti-DNMT1 antibody
[KD Validated] DNMT1 Rabbit mAb
Reactivity
Human
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Affinity purification
Synonyms
DNMT1, Antibody; [KD Validated] DNMT1 Rabbit mAb; AIM; DNMT; MCMT; CXXC9; HSN1E; ADCADN; m.HsaI; [KD Validated] DNMT1; anti-DNMT1 antibody
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
MPARTAPARVPTLAVPAISLPDDVRRRLKDLERDSLTEKECVKEKLNLLHEFLQTEIKNQLCDLETKLRKEELSEEGYLAKVKSLLNKDLSLENGAHAYN
Applicable Applications for anti-DNMT1 antibody
ELISA, IP (Immunoprecipitation), WB (Western Blot)
Cross Reactivity
Human, Mouse, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human DNMT1 (NP_001370.1).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
IP (Immunoprecipitation)
(Immunoprecipitation of DNMT1 from 300 ug extracts of Jurkat cells was performed using 3 ug of DNMT1 Rabbit mAb (AAA282786). Rabbit IgG isotype control (AC042) was used to precipitate the Control IgG sample. IP samples were eluted with 1X reducing Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using DNMT1 Rabbit mAb (AAA282786) at a dilution of 1:1000.)
IP (Immunoprecipitation)
(Immunoprecipitation of DNMT1 from 300 ug extracts of Jurkat cells was performed using 3 ug of DNMT1 Rabbit mAb (AAA282786). Rabbit IgG isotype control (AC042) was used to precipitate the Control IgG sample. IP samples were eluted with 1X reducing Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using DNMT1 Rabbit mAb (AAA282786) at a dilution of 1:1000.)
WB (Western Blot)
(Western blot analysis of lysates from wild type (WT) and DNMT1 knockdown (KD) 293T cells, using [KD Validated] DNMT1 Rabbit mAb (AAA282786) at1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)
WB (Western Blot)
(Western blot analysis of lysates from wild type (WT) and DNMT1 knockdown (KD) 293T cells, using [KD Validated] DNMT1 Rabbit mAb (AAA282786) at1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)
WB (Western Blot)
(Western blot analysis of various lysates using [KD Validated] DNMT1 Rabbit mAb (AAA282786) at 1:1000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020)Exposure time: 30 s.)
WB (Western Blot)
(Western blot analysis of various lysates using [KD Validated] DNMT1 Rabbit mAb (AAA282786) at 1:1000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020)Exposure time: 30 s.)
Related Product Information for anti-DNMT1 antibody
This gene encodes an enzyme that transfers methyl groups to cytosine nucleotides of genomic DNA. This protein is the major enzyme responsible for maintaining methylation patterns following DNA replication and shows a preference for hemi-methylated DNA. Methylation of DNA is an important component of mammalian epigenetic gene regulation. Aberrant methylation patterns are found in human tumors and associated with developmental abnormalities. Variation in this gene has been associated with cerebellar ataxia, deafness, and narcolepsy, and neuropathy, hereditary sensory, type IE. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-DNMT1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
Calculated MW: 183kDa
Observed MW: 200kDa
Observed MW: 200kDa
UniProt Protein Name
DNA (cytosine-5)-methyltransferase 1
UniProt Gene Name
DNMT1
UniProt Synonym Gene Names
AIM; CXXC9; DNMT; Dnmt1; DNA MTase HsaI; M.HsaI
UniProt Entry Name
DNMT1_HUMAN
Similar Products
Product Notes
The DNMT1 dnmt1 (Catalog #AAA282786) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The [KD Validated] DNMT1 Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DNMT1 can be used in a range of immunoassay formats including, but not limited to, ELISA, IP (Immunoprecipitation), WB (Western Blot). Researchers should empirically determine the suitability of the DNMT1 dnmt1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MPARTAPARV PTLAVPAISL PDDVRRRLKD LERDSLTEKE CVKEKLNLLH EFLQTEIKNQ LCDLETKLRK EELSEEGYLA KVKSLLNKDL SLENGAHAYN. It is sometimes possible for the material contained within the vial of "DNMT1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.