Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198162_WB11.jpg WB (Western Blot) (WB Suggested Anti-Dnmt1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Mouse Lung)

Rabbit anti-Mouse Dnmt1 Polyclonal Antibody | anti-DNMT1 antibody

Dnmt1 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
Dnmt1; Dnmt; MCMT; Met1; Cxxc9; MTase; Met-1; Dnmt1o; m.MmuI; MommeD2
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Dnmt1, Antibody; Dnmt1 antibody - N-terminal region; anti-DNMT1 antibody
Ordering
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SSVATRRTTRQTTITAHFTKGPTKRKPKEESEEGNSAESAAEERDQDKKR
Sequence Length
1619
Applicable Applications for anti-DNMT1 antibody
WB (Western Blot)
Homology
Mouse: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of mouse Dnmt1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-Dnmt1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Mouse Lung)

product-image-AAA198162_WB11.jpg WB (Western Blot) (WB Suggested Anti-Dnmt1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Mouse Lung)

WB (Western Blot)

(Researcher:Austin J. Cooney, Baylor College of MedicineApplication:Western blottingSpecies+tissue/cell type: Lane 1: 15ug WT mouse ES lysate Lane 2: 15ug DNMT1 KO mouse ES lysatePrimary antibody dilution:1:1000Secondary antibody:Goat anti-rabbit-HRPSecondary antibody dilution:1:2500)

product-image-AAA198162_WB13.jpg WB (Western Blot) (Researcher:Austin J. Cooney, Baylor College of MedicineApplication:Western blottingSpecies+tissue/cell type: Lane 1: 15ug WT mouse ES lysate Lane 2: 15ug DNMT1 KO mouse ES lysatePrimary antibody dilution:1:1000Secondary antibody:Goat anti-rabbit-HRPSecondary antibody dilution:1:2500)

WB (Western Blot)

(Researcher: AnonymousApplication: Western BlottingSpecies+tissue/cell type: Lane 1: 20ug mouse mesenchymal stem cell lysatePrimary antibody dilution: 1:2000Secondary antibody: Anti-rabbit-HRPSecondary antibody dilution: 1:10,000)

product-image-AAA198162_WB15.jpg WB (Western Blot) (Researcher: AnonymousApplication: Western BlottingSpecies+tissue/cell type: Lane 1: 20ug mouse mesenchymal stem cell lysatePrimary antibody dilution: 1:2000Secondary antibody: Anti-rabbit-HRPSecondary antibody dilution: 1:10,000)
Related Product Information for anti-DNMT1 antibody
This is a rabbit polyclonal antibody against Dnmt1. It was validated on Western Blot

Target Description: Dnmt1 methylates CpG residues.Dnmt1 preferentially methylates hemimethylated DNA. Dnmt1 associates with DNA replication sites in S phase maintaining the methylation pattern in the newly synthesized strand, that is essential for epigenetic inheritance.Dnmt1 associates with chromatin during G2 and M phases to maintain DNA methylation independently of replication. It is responsible for maintaining methylation patterns established in development. DNA methylation is coordinated with methylation of histones.Dnmt1 mediates transcriptional repression by direct binding to HDAC2. In association with DNMT3B and via the recruitment of CTCFL/BORIS, Dnmt1 is involved in activation of BAG1 gene expression by modulating dimethylation of promoter histone H3 at H3K4 and H3K9.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
183kDa
NCBI Official Full Name
DNA (cytosine-5)-methyltransferase 1 isoform 2
NCBI Official Synonym Full Names
DNA methyltransferase (cytosine-5) 1
NCBI Official Symbol
Dnmt1
NCBI Official Synonym Symbols
Dnmt; MCMT; Met1; Cxxc9; MTase; Met-1; Dnmt1o; m.MmuI; MommeD2
NCBI Protein Information
DNA (cytosine-5)-methyltransferase 1
UniProt Protein Name
DNA (cytosine-5)-methyltransferase 1
UniProt Gene Name
Dnmt1
UniProt Synonym Gene Names
Dnmt; Met1; Uim; Dnmt1; Met-1; DNA MTase MmuI; M.MmuI
UniProt Entry Name
DNMT1_MOUSE

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The DNMT1 dnmt1 (Catalog #AAA198162) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Dnmt1 antibody - N-terminal region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's Dnmt1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the DNMT1 dnmt1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SSVATRRTTR QTTITAHFTK GPTKRKPKEE SEEGNSAESA AEERDQDKKR. It is sometimes possible for the material contained within the vial of "Dnmt1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.