Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282746_IP11.jpg IP (Immunoprecipitation) (Immunoprecipitation analysis of 300 ug extracts of HT-29 cells using 3 ug E2F1 antibody (AAA282746). Western blot was performed from the immunoprecipitate using E2F1 antibody (AAA282746) at a dilution of 1:1000.)

Rabbit anti-Human E2F1 Monoclonal Antibody | anti-E2F1 antibody

E2F1 Rabbit mAb

Reactivity
Human
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Affinity purification
Synonyms
E2F1, Antibody; E2F1 Rabbit mAb; RBP3; E2F-1; RBAP1; RBBP3; E2F1; anti-E2F1 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
PPSSLTTDPSQSLLSLEQEPLLSRMGSLRAPVDEDRLSPLVAADSLLEHVREDFSGLLPEEFISLSPPHEALDYHFGLEEGEGIRDLFDCDFGDLTPLDF
Applicable Applications for anti-E2F1 antibody
ELISA, IP (Immunoprecipitation), WB (Western Blot)
Cross Reactivity
Human, Mouse, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 338-437 of human E2F1 (Q01094).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IP (Immunoprecipitation)

(Immunoprecipitation analysis of 300 ug extracts of HT-29 cells using 3 ug E2F1 antibody (AAA282746). Western blot was performed from the immunoprecipitate using E2F1 antibody (AAA282746) at a dilution of 1:1000.)

product-image-AAA282746_IP11.jpg IP (Immunoprecipitation) (Immunoprecipitation analysis of 300 ug extracts of HT-29 cells using 3 ug E2F1 antibody (AAA282746). Western blot was performed from the immunoprecipitate using E2F1 antibody (AAA282746) at a dilution of 1:1000.)

WB (Western Blot)

(Western blot analysis of lysates from rat spleen, using E2F1 Rabbit mAb (AAA282746) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1min.)

product-image-AAA282746_WB13.jpg WB (Western Blot) (Western blot analysis of lysates from rat spleen, using E2F1 Rabbit mAb (AAA282746) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1min.)

WB (Western Blot)

(Western blot analysis of various lysates using E2F1 Rabbit mAb (AAA282746) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)

product-image-AAA282746_WB15.jpg WB (Western Blot) (Western blot analysis of various lysates using E2F1 Rabbit mAb (AAA282746) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)
Related Product Information for anti-E2F1 antibody
The protein encoded by this gene is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein and another 2 members, E2F2 and E2F3, have an additional cyclin binding domain. This protein binds preferentially to retinoblastoma protein pRB in a cell-cycle dependent manner. It can mediate both cell proliferation and p53-dependent/independent apoptosis.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated MW: 47kDa
Observed MW: 70kDa
UniProt Protein Name
Transcription factor E2F1
UniProt Gene Name
E2F1
UniProt Synonym Gene Names
RBBP3; E2F-1; RBAP-1; RBBP-3
UniProt Entry Name
E2F1_HUMAN

Similar Products

Product Notes

The E2F1 e2f1 (Catalog #AAA282746) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The E2F1 Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's E2F1 can be used in a range of immunoassay formats including, but not limited to, ELISA, IP (Immunoprecipitation), WB (Western Blot). Researchers should empirically determine the suitability of the E2F1 e2f1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: PPSSLTTDPS QSLLSLEQEP LLSRMGSLRA PVDEDRLSPL VAADSLLEHV REDFSGLLPE EFISLSPPHE ALDYHFGLEE GEGIRDLFDC DFGDLTPLDF. It is sometimes possible for the material contained within the vial of "E2F1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.