Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Have a question or looking for a specific datasheet Manual/COA/MSDS?
Submit a Question

Interested to get a quote about our products?
Request a Quote

IP (Immunoprecipitation)
>
<
IP (Immunoprecipitation) (Immunoprecipitation analysis of 300 ug extracts of HeLa cells using 3 ug Fatty Acid Synthase (FASN) antibody (AAA28473). Western blot was performed from the immunoprecipitate using Fatty Acid Synthase (FASN) antibody (AAA28473) at a dilution of 1:500.)

Rabbit anti-Human Fatty Acid Synthase (FASN) Monoclonal Antibody | anti-FASN antibody

Fatty Acid Synthase (FASN) Rabbit mAb

Reactivity
Human
Applications
Western Blot, Immunohistochemistry, Immunofluorescence, Immunocytochemistry, Immunoprecipitation, ELISA
Purity
Affinity purification
Synonyms
Fatty Acid Synthase (FASN); Monoclonal Antibody; Fatty Acid Synthase (FASN) Rabbit mAb; FAS; OA-519; SDR27X1; anti-FASN antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
AVDLIIKSHQGLDRQELSFAARSFYYKLRAAEQYTPKAKYHGNVMLLRAKTGGAYGEDLGADYNLSQVCDGKVSVHVIEGDHRTLLEGSGLESIISIIHSS
Applicable Applications for anti-FASN antibody
Western Blot (WB), Immunohistochemistry-Paraffin (IHC-P), Immunofluorescence (IF), Immunocytochemistry (ICC), Immunoprecipitation (IP), ELISA (EIA)
Application Notes
WB: 1:1000-1:2000
IHC-P: 1:500-1:2000
IF/ICC: 1:100-1:800
IP: 0.5ug-4ug antibody for 200ug-400ug extracts of whole cells
ELISA: Recommended starting concentration is 1ug/mL.
Please optimize the concentration based on your specific assay requirements.
Cross Reactivity
Human, Mouse, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 2400-2500 of human FASN (P49327).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IP (Immunoprecipitation)

(Immunoprecipitation analysis of 300 ug extracts of HeLa cells using 3 ug Fatty Acid Synthase (FASN) antibody (AAA28473). Western blot was performed from the immunoprecipitate using Fatty Acid Synthase (FASN) antibody (AAA28473) at a dilution of 1:500.)

IP (Immunoprecipitation) (Immunoprecipitation analysis of 300 ug extracts of HeLa cells using 3 ug Fatty Acid Synthase (FASN) antibody (AAA28473). Western blot was performed from the immunoprecipitate using Fatty Acid Synthase (FASN) antibody (AAA28473) at a dilution of 1:500.)

IF (Immunofluorescence)

(Immunofluorescence analysis of HeLa cells using Fatty Acid Synthase (FASN) Rabbit mAb (AAA28473) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence) (Immunofluorescence analysis of HeLa cells using Fatty Acid Synthase (FASN) Rabbit mAb (AAA28473) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of NIH/3T3 cells using Fatty Acid Synthase (FASN) Rabbit mAb (AAA28473) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence) (Immunofluorescence analysis of NIH/3T3 cells using Fatty Acid Synthase (FASN) Rabbit mAb (AAA28473) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Rat fat tissue using Fatty Acid Synthase (FASN) Rabbit mAb (AAA28473) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Rat fat tissue using Fatty Acid Synthase (FASN) Rabbit mAb (AAA28473) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Mouse skin tissue using Fatty Acid Synthase (FASN) Rabbit mAb (AAA28473) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Mouse skin tissue using Fatty Acid Synthase (FASN) Rabbit mAb (AAA28473) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human lung cancer tissue using Fatty Acid Synthase (FASN) Rabbit mAb (AAA28473) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Human lung cancer tissue using Fatty Acid Synthase (FASN) Rabbit mAb (AAA28473) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human breast cancer tissue using Fatty Acid Synthase (FASN) Rabbit mAb (AAA28473) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Human breast cancer tissue using Fatty Acid Synthase (FASN) Rabbit mAb (AAA28473) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

WB (Western Blot)

(Western blot analysis of various lysates using Fatty Acid Synthase (FASN) Rabbit mAb (AAA28473) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 3min.)

WB (Western Blot) (Western blot analysis of various lysates using Fatty Acid Synthase (FASN) Rabbit mAb (AAA28473) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 3min.)
Related Product Information for anti-FASN antibody
The enzyme encoded by this gene is a multifunctional protein. Its main function is to catalyze the synthesis of palmitate from acetyl-CoA and malonyl-CoA, in the presence of NADPH, into long-chain saturated fatty acids. In some cancer cell lines, this protein has been found to be fused with estrogen receptor-alpha (ER-alpha), in which the N-terminus of FAS is fused in-frame with the C-terminus of ER-alpha.
Product Categories/Family for anti-FASN antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated MW: 273kDa
Observed MW: 273kDa
UniProt Protein Name
Fatty acid synthase
UniProt Gene Name
FASN
UniProt Synonym Gene Names
FAS
UniProt Entry Name
FAS_HUMAN

Similar Products

FASN Antibody

Host: Rabbit
Reactivity: Human
Apps: Western Blot, Immunohistochemistry, Immunofluorescence, Immunocytochemistry, Immunoprecipitation, ELISA

FASN Antibody

Host: n/a
Reactivity: Human
Apps: ELISA, Western Blot

FASN Antibody

Host: Rabbit
Reactivity: Human, Mouse, Rat
Apps: Western Blot, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Immunoprecipitation, Flow Cytometry, Functional Assay

FFA ELISA Kit

Host: n/a
Reactivity: Mouse
Apps: n/a

FFA ELISA Kit

Host: n/a
Reactivity: Human
Apps: n/a

FFA ELISA Kit

Host: n/a
Reactivity: Rat
Apps: n/a

NEFA ELISA Kit

Host: n/a
Reactivity: Monkey
Apps: n/a

NEFA ELISA Kit

Host: n/a
Reactivity: Goat
Apps: n/a

FFA ELISA Kit

Host: n/a
Reactivity: Porcine
Apps: n/a

FFA ELISA Kit

Host: n/a
Reactivity: Rat
Apps: n/a

NEFA ELISA Kit

Host: n/a
Reactivity: Mouse
Apps: n/a

NEFA ELISA Kit

Host: n/a
Reactivity: Bovine
Apps: n/a

A FABP ELISA Kit

Host: n/a
Reactivity: Human
Apps: n/a

Fads2 ELISA Kit

Host: n/a
Reactivity: Mouse
Apps: n/a

Fads3 ELISA Kit

Host: n/a
Reactivity: Mouse
Apps: n/a

IFABP/FABP2 ELISA Kit

Host: n/a
Reactivity: Mouse
Apps: n/a

FAAH ELISA Kit

Host: n/a
Reactivity: Rat
Apps: n/a

FATP1 ELISA Kit

Host: n/a
Reactivity: Human
Apps: n/a

FAAH ELISA Kit

Host: n/a
Reactivity: Mouse
Apps: n/a

Product Notes

The FASN fasn (Catalog #AAA28473) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Fatty Acid Synthase (FASN) Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Fatty Acid Synthase (FASN) can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry-Paraffin (IHC-P), Immunofluorescence (IF), Immunocytochemistry (ICC), Immunoprecipitation (IP), ELISA (EIA). WB: 1:1000-1:2000 IHC-P: 1:500-1:2000 IF/ICC: 1:100-1:800 IP: 0.5ug-4ug antibody for 200ug-400ug extracts of whole cells ELISA: Recommended starting concentration is 1ug/mL. Please optimize the concentration based on your specific assay requirements. Researchers should empirically determine the suitability of the FASN fasn for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: AVDLIIKSHQ GLDRQELSFA ARSFYYKLRA AEQYTPKAKY HGNVMLLRAK TGGAYGEDLG ADYNLSQVCD GKVSVHVIEG DHRTLLEGSG LESIISIIHS S. It is sometimes possible for the material contained within the vial of "Fatty Acid Synthase (FASN), Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

aaabiotech.com © 2012-2025

All rights reserved.

Contact us by

Tel: +1 (619) 604-9440 | Fax: +1 (619) 604-9440
[email protected]

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.