<
IHC (Immunohistchemistry)
(Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using FGFR3 Rabbit mAb (AAA28474) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)
Rabbit anti-Human FGFR3 Monoclonal Antibody | anti-FGFR3 antibody
FGFR3 Rabbit mAb
Reactivity
Human
Applications
Western Blot, Immunohistochemistry, ELISA
Purity
Affinity purification
Synonyms
FGFR3, Antibody; FGFR3 Rabbit mAb; ACH; CEK2; JTK4; CD333; HSFGFR3EX; FGFR3; anti-FGFR3 antibody
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
MGAPACALALCVAVAIVAGASSESLGTEQRVVGRAAEVPGPEPGQQEQLVFGSGDAVELSCPPPGGGPMGPTVWVKDGTGLVPSERVLVGPQRLQVLNAS
Applicable Applications for anti-FGFR3 antibody
Western Blot (WB), Immunohistochemistry-Paraffin (IHC-P), ELISA (EIA)
Application Notes
WB: 1:1000-1:4000
IHC-P: 1:1000-1:5000
ELISA: Recommended starting concentration is 1ug/mL.
Please optimize the concentration based on your specific assay requirements.
IHC-P: 1:1000-1:5000
ELISA: Recommended starting concentration is 1ug/mL.
Please optimize the concentration based on your specific assay requirements.
Cross Reactivity
Human, Mouse, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human FGFR3 (P22607).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
IHC (Immunohistchemistry)
(Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using FGFR3 Rabbit mAb (AAA28474) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)
IHC (Immunohistchemistry)
(Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using FGFR3 Rabbit mAb (AAA28474) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)
IHC (Immunohistochemistry)
(Immunohistochemistry analysis of paraffin-embedded Human testis tissue using FGFR3 Rabbit mAb (AAA28474) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)
IHC (Immunohistochemistry)
(Immunohistochemistry analysis of paraffin-embedded Human testis tissue using FGFR3 Rabbit mAb (AAA28474) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)
IHC (Immunohistochemistry)
(Immunohistochemistry analysis of paraffin-embedded Human breast cancer tissue using FGFR3 Rabbit mAb (AAA28474) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)
IHC (Immunohistochemistry)
(Immunohistochemistry analysis of paraffin-embedded Human breast cancer tissue using FGFR3 Rabbit mAb (AAA28474) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)
IHC (Immunohistochemistry)
(Immunohistochemistry analysis of paraffin-embedded Human pancreas tissue using FGFR3 Rabbit mAb (AAA28474) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)
IHC (Immunohistochemistry)
(Immunohistochemistry analysis of paraffin-embedded Human pancreas tissue using FGFR3 Rabbit mAb (AAA28474) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)
IHC (Immunohistochemistry)
(Immunohistochemistry analysis of paraffin-embedded Human brain tissue using FGFR3 Rabbit mAb (AAA28474) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)
IHC (Immunohistochemistry)
(Immunohistochemistry analysis of paraffin-embedded Human brain tissue using FGFR3 Rabbit mAb (AAA28474) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)
WB (Western Blot)
(Western blot analysis of various lysates using FGFR3 Rabbit mAb (AAA28474) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3min.)
WB (Western Blot)
(Western blot analysis of various lysates using FGFR3 Rabbit mAb (AAA28474) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3min.)
Related Product Information for anti-FGFR3 antibody
This gene encodes a member of the fibroblast growth factor receptor (FGFR) family, with its amino acid sequence being highly conserved between members and among divergent species. FGFR family members differ from one another in their ligand affinities and tissue distribution. A full-length representative protein would consist of an extracellular region, composed of three immunoglobulin-like domains, a single hydrophobic membrane-spanning segment and a cytoplasmic tyrosine kinase domain. The extracellular portion of the protein interacts with fibroblast growth factors, setting in motion a cascade of downstream signals, ultimately influencing mitogenesis and differentiation. This particular family member binds acidic and basic fibroblast growth hormone and plays a role in bone development and maintenance. Mutations in this gene lead to craniosynostosis and multiple types of skeletal dysplasia.
Product Categories/Family for anti-FGFR3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated MW: 88kDa
Observed MW: 110kDa
Observed MW: 110kDa
UniProt Protein Name
Fibroblast growth factor receptor 3
UniProt Gene Name
FGFR3
UniProt Synonym Gene Names
JTK4; FGFR-3
UniProt Entry Name
FGFR3_HUMAN
Similar Products
Product Notes
The FGFR3 fgfr3 (Catalog #AAA28474) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FGFR3 Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FGFR3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry-Paraffin (IHC-P), ELISA (EIA). WB: 1:1000-1:4000 IHC-P: 1:1000-1:5000 ELISA: Recommended starting concentration is 1ug/mL. Please optimize the concentration based on your specific assay requirements. Researchers should empirically determine the suitability of the FGFR3 fgfr3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MGAPACALAL CVAVAIVAGA SSESLGTEQR VVGRAAEVPG PEPGQQEQLV FGSGDAVELS CPPPGGGPMG PTVWVKDGTG LVPSERVLVG PQRLQVLNAS. It is sometimes possible for the material contained within the vial of "FGFR3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.