Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA31475_IHC8.jpg IHC (Immunohistochemistry) (AAA31475 at 1/100 staining rat testis tissue by IHC-P. The sample was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The sample was then blocked and incubated with the primary antibody at 4 degree C overnight. An HRP conjugated anti-mouse antibody was used as the secondary antibody.)

Mouse hnRNP A1 Monoclonal Antibody | anti-HNRNPA1 antibody

hnRNP A1 Mouse Monoclonal Antibody

Reactivity
Human, Mouse, Rat
Prediction: Pig, Bovine, Sheep, Dog, Chicken, Xenopus
Applications
Western Blot, Immunohistochemistry
Purity
Affinity-chromatography.
Synonyms
hnRNP A1, Antibody; hnRNP A1 Mouse Monoclonal Antibody; HNRNPA 1; Helix destabilizing protein; Helix-destabilizing protein; Heterogeneous nuclear ribonucleoprotein A1; Heterogeneous nuclear ribonucleoprotein A1B protein; Heterogeneous nuclear ribonucleoprotein B2 protein; Heterogeneous nuclear ribonucleoprotein core protein A1; hnRNP A1; hnRNP core protein A1; HNRNPA1; HNRPA1; MGC102835; Nuclear ribonucleoprotein particle A1 protein; ROA1_HUMAN; Single strand DNA binding protein UP1; Single strand RNA binding protein; Single-strand RNA-binding protein; anti-HNRNPA1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Prediction: Pig, Bovine, Sheep, Dog, Chicken, Xenopus
Clonality
Monoclonal
Isotype
Mouse IgG1
Specificity
hnRNP A1 Antibody detects endogenous levels of total hnRNP A1.
Purity/Purification
Affinity-chromatography.
Form/Format
Mouse IgG1 in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Sequence
MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGGYGGGGPGYSGGSRGYGSGGQGYGNQGSGYGGSGSYDSYNNGGGGGFGGGSGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGYGGSSSSSSYGSGRRF
Applicable Applications for anti-HNRNPA1 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
IHC: 1:50-1:200
WB: 1:1000-1:10000
Immunogen
A synthesized peptide derived from human hnRNP A1, corresponding to a region within the internal amino acids.
Conjugation
Unconjugated
Preparation and Storage
Store at -20 degree C. Stable for 12 months from date of receipt.

IHC (Immunohistochemistry)

(AAA31475 at 1/100 staining rat testis tissue by IHC-P. The sample was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The sample was then blocked and incubated with the primary antibody at 4 degree C overnight. An HRP conjugated anti-mouse antibody was used as the secondary antibody.)

product-image-AAA31475_IHC8.jpg IHC (Immunohistochemistry) (AAA31475 at 1/100 staining rat testis tissue by IHC-P. The sample was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The sample was then blocked and incubated with the primary antibody at 4 degree C overnight. An HRP conjugated anti-mouse antibody was used as the secondary antibody.)

IHC (Immunohistochemistry)

(AAA31475 at 1/100 staining rat brain tissue by IHC-P. The sample was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The sample was then blocked and incubated with the primary antibody at 4 degree C overnight. An HRP conjugated anti-mouse antibody was used as the secondary antibody.)

product-image-AAA31475_IHC7.jpg IHC (Immunohistochemistry) (AAA31475 at 1/100 staining rat brain tissue by IHC-P. The sample was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The sample was then blocked and incubated with the primary antibody at 4 degree C overnight. An HRP conjugated anti-mouse antibody was used as the secondary antibody.)

IHC (Immunohistchemistry)

(AAA31475 at 1/100 staining mouse testis tissue by IHC-P. The sample was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The sample was then blocked and incubated with the primary antibody at 4 degree C overnight. An HRP conjugated anti-mouse antibody was used as the secondary antibody.)

product-image-AAA31475_IHC6.jpg IHC (Immunohistchemistry) (AAA31475 at 1/100 staining mouse testis tissue by IHC-P. The sample was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The sample was then blocked and incubated with the primary antibody at 4 degree C overnight. An HRP conjugated anti-mouse antibody was used as the secondary antibody.)

IHC (Immunohistochemistry)

(AAA31475 at 1/100 staining human ovarian cancer sections by IHC-P. The tissue was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The tissue was then blocked and incubated with the antibody for 1.5 hours at 22 degree C. An HRP conjugated goat anti-mouse antibody was used as the secondary antibody.)

product-image-AAA31475_IHC5.jpg IHC (Immunohistochemistry) (AAA31475 at 1/100 staining human ovarian cancer sections by IHC-P. The tissue was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The tissue was then blocked and incubated with the antibody for 1.5 hours at 22 degree C. An HRP conjugated goat anti-mouse antibody was used as the secondary antibody.)

IHC (Immunohistochemistry)

(AAA31475 at 1/100 staining human prostate cancer by IHC-P. The sample was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The sample was then blocked and incubated with the primary antibody at 4 degree C overnight. An HRP conjugated anti-mouse antibody was used as the secondary antibody.)

product-image-AAA31475_IHC4.jpg IHC (Immunohistochemistry) (AAA31475 at 1/100 staining human prostate cancer by IHC-P. The sample was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The sample was then blocked and incubated with the primary antibody at 4 degree C overnight. An HRP conjugated anti-mouse antibody was used as the secondary antibody.)

IHC (Immunohistochemistry)

(AAA31475 at 1/100 staining human colorectal cancer by IHC-P. The sample was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The sample was then blocked and incubated with the primary antibody at 4 degree C overnight. An HRP conjugated anti-mouse antibody was used as the secondary antibody.)

product-image-AAA31475_IHC3.jpg IHC (Immunohistochemistry) (AAA31475 at 1/100 staining human colorectal cancer by IHC-P. The sample was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The sample was then blocked and incubated with the primary antibody at 4 degree C overnight. An HRP conjugated anti-mouse antibody was used as the secondary antibody.)

IHC (Immunohistochemistry)

(AAA31475 at 1/100 staining human gastric cancer by IHC-P. The sample was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The sample was then blocked and incubated with the primary antibody at 4 degree C overnight. An HRP conjugated anti-mouse antibody was used as the secondary antibody.)

product-image-AAA31475_IHC2.jpg IHC (Immunohistochemistry) (AAA31475 at 1/100 staining human gastric cancer by IHC-P. The sample was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The sample was then blocked and incubated with the primary antibody at 4 degree C overnight. An HRP conjugated anti-mouse antibody was used as the secondary antibody.)

WB (Western Blot)

(Western blot analysis of extracts from various samples, using hnRNP A1 Antibody(1:10k, 10s exp). Lane 1: Raw264.7 cells treated with blocking peptide, Lane 2: Raw264.7 cells, Lane 3: A375 cells.)

product-image-AAA31475_WB.jpg WB (Western Blot) (Western blot analysis of extracts from various samples, using hnRNP A1 Antibody(1:10k, 10s exp). Lane 1: Raw264.7 cells treated with blocking peptide, Lane 2: Raw264.7 cells, Lane 3: A375 cells.)
Product Categories/Family for anti-HNRNPA1 antibody

NCBI and Uniprot Product Information

NCBI GeneID
UniProt Accession #
Molecular Weight
33 kD; 39kD(Calculated)

Similar Products

Product Notes

The HNRNPA1 (Catalog #AAA31475) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The hnRNP A1 Mouse Monoclonal Antibody reacts with Human, Mouse, Rat Prediction: Pig, Bovine, Sheep, Dog, Chicken, Xenopus and may cross-react with other species as described in the data sheet. AAA Biotech's hnRNP A1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). IHC: 1:50-1:200 WB: 1:1000-1:10000. Researchers should empirically determine the suitability of the HNRNPA1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSKSESPKEP EQLRKLFIGG LSFETTDESL RSHFEQWGTL TDCVVMRDPN TKRSRGFGFV TYATVEEVDA AMNARPHKVD GRVVEPKRAV SREDSQRPGA HLTVKKIFVG GIKEDTEEHH LRDYFEQYGK IEVIEIMTDR GSGKKRGFAF VTFDDHDSVD KIVIQKYHTV NGHNCEVRKA LSKQEMASAS SSQRGRSGSG NFGGGRGGGF GGNDNFGRGG NFSGRGGFGG SRGGGGYGGS GDGYNGFGND GGYGGGGPGY SGGSRGYGSG GQGYGNQGSG YGGSGSYDSY NNGGGGGFGG GSGSNFGGGG SYNDFGNYNN QSSNFGPMKG GNFGGRSSGP YGGGGQYFAK PRNQGGYGGS SSSSSYGSGR RF. It is sometimes possible for the material contained within the vial of "hnRNP A1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.