Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA25396_WB7.jpg WB (Western Blot) (FLJ23356 monoclonal antibody. Western Blot analysis of FLJ23356 expression in HeLa.)

Mouse anti-Human FLJ23356 Monoclonal Antibody | anti-FLJ23356 antibody

FLJ23356 (SGK196, Probable Inactive Protein Kinase-like Protein SgK196, Sugen Kinase 196, MGC126597) (HRP)

Average rating 0.0
No ratings yet
Gene Names
POMK; SGK196; MDDGA12; MDDGC12
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
FLJ23356, Antibody; FLJ23356 (SGK196, Probable Inactive Protein Kinase-like Protein SgK196, Sugen Kinase 196, MGC126597) (HRP); anti-FLJ23356 antibody
Ordering
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
6F10
Specificity
Recognizes human FLJ23356.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-FLJ23356 antibody
ELISA, WB (Western Blot)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa251-351 from human FLJ23356 (NP_115613) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GDFVAPEQLWPYGEDVPFHDDLMPSYDEKIDIWKIPDISSFLLGHIEGSDMVRFHLFDIHKACKSQTPSERPTAQDVLETYQKVLDTLRDAMMSQAREML
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(FLJ23356 monoclonal antibody. Western Blot analysis of FLJ23356 expression in HeLa.)

product-image-AAA25396_WB7.jpg WB (Western Blot) (FLJ23356 monoclonal antibody. Western Blot analysis of FLJ23356 expression in HeLa.)

WB (Western Blot)

(FLJ23356 monoclonal antibody. Western Blot analysis of FLJ23356 expression in HepG2.)

product-image-AAA25396_WB6.jpg WB (Western Blot) (FLJ23356 monoclonal antibody. Western Blot analysis of FLJ23356 expression in HepG2.)

Application Data

(Detection limit for recombinant GST tagged FLJ23356 is ~0.1ng/ml as a capture antibody.)

product-image-AAA25396_APP5.jpg Application Data (Detection limit for recombinant GST tagged FLJ23356 is ~0.1ng/ml as a capture antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to FLJ23356 on HeLa cell. [antibody concentration 10ug/ml].)

product-image-AAA25396_IF4.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to FLJ23356 on HeLa cell. [antibody concentration 10ug/ml].)

WB (Western Blot)

(Western Blot analysis of FLJ23356 expression in transfected 293T cell line by FLJ23356 monoclonal antibody. Lane 1: FLJ23356 transfected lysate (38.5kD). Lane 2: Non-transfected lysate.)

product-image-AAA25396_WB3.jpg WB (Western Blot) (Western Blot analysis of FLJ23356 expression in transfected 293T cell line by FLJ23356 monoclonal antibody. Lane 1: FLJ23356 transfected lysate (38.5kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(Western blot analysis of FLJ23356 over-expressed 293 cell line, cotransfected with FLJ23356 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with FLJ23356 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

product-image-AAA25396_WB2.jpg WB (Western Blot) (Western blot analysis of FLJ23356 over-expressed 293 cell line, cotransfected with FLJ23356 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with FLJ23356 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

WB (Western Blot)

(Western Blot detection against Immunogen (37.11kD).)

product-image-AAA25396_WB.jpg WB (Western Blot) (Western Blot detection against Immunogen (37.11kD).)
Related Product Information for anti-FLJ23356 antibody
SGK196 belongs to the protein kinase superfamily. Ser/Thr protein kinase family. STKL subfamily.
Product Categories/Family for anti-FLJ23356 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Full Name
protein O-mannose kinase
NCBI Official Synonym Full Names
protein-O-mannose kinase
NCBI Official Symbol
POMK
NCBI Official Synonym Symbols
SGK196; MDDGA12; MDDGC12
NCBI Protein Information
protein O-mannose kinase
UniProt Protein Name
Protein O-mannose kinase
UniProt Gene Name
POMK
UniProt Synonym Gene Names
SGK196; POMK
UniProt Entry Name
SG196_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The FLJ23356 pomk (Catalog #AAA25396) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FLJ23356 (SGK196, Probable Inactive Protein Kinase-like Protein SgK196, Sugen Kinase 196, MGC126597) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FLJ23356 can be used in a range of immunoassay formats including, but not limited to, ELISA, WB (Western Blot). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FLJ23356 pomk for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FLJ23356, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request Manual

Please complete the form below and a representative will contact you as soon as possible.

Request Quote

Please complete the form below and a representative will contact you as soon as possible.