Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA23415_WB6.jpg WB (Western Blot) (WB Suggested Anti-FOXA1 antibody Titration: 1 ug/mLSample Type: Human liver)

Rabbit FOXA1 Polyclonal Antibody | anti-FOXA1 antibody

FOXA1 antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
FOXA1; HNF3A; TCF3A
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rat, Yeast, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
FOXA1, Antibody; FOXA1 antibody - C-terminal region; anti-FOXA1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SFNHPFSINNLMSSSEQQHKLDFKAYEQALQYSPYGSTLPASLPLGSASV
Sequence Length
472
Applicable Applications for anti-FOXA1 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Yeast: 83%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human FOXA1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-FOXA1 antibody Titration: 1 ug/mLSample Type: Human liver)

product-image-AAA23415_WB6.jpg WB (Western Blot) (WB Suggested Anti-FOXA1 antibody Titration: 1 ug/mLSample Type: Human liver)

WB (Western Blot)

(WB Suggested Anti-FOXA1 antibody Titration: 1 ug/mLSample Type: Human heart)

product-image-AAA23415_WB5.jpg WB (Western Blot) (WB Suggested Anti-FOXA1 antibody Titration: 1 ug/mLSample Type: Human heart)

WB (Western Blot)

(WB Suggested Anti-FOXA1 Antibody Titration: 0.2-1 ug/mlPositive Control: Transfected 293T)

product-image-AAA23415_WB4.jpg WB (Western Blot) (WB Suggested Anti-FOXA1 Antibody Titration: 0.2-1 ug/mlPositive Control: Transfected 293T)

WB (Western Blot)

(WB Suggested Anti-FOXA1 AntibodyPositive Control: Lane 1: 20ug MCF7 cell lysates Lane 2: 20ug MCF7 cell lysates Lane 3: 20ug MCF7 cell lysates Lane 4: 20ug MCF7 cell lysates Lane 5: 20ug MCF7 with FoxA1 knockdown Lane 6: 20ug MCF7 with FoxA1 knockdownPrimary Antibody Dilution : 1:1000Secondary Antibody : Anti-rabbit-HRPSecondry Antibody Dilution : 1:2000Submitted by: Fu, Xiaoyong, Baylor College of MedicineFOXA1 is supported by BioGPS gene expression data to be expressed in MCF7)

product-image-AAA23415_WB3.jpg WB (Western Blot) (WB Suggested Anti-FOXA1 AntibodyPositive Control: Lane 1: 20ug MCF7 cell lysates Lane 2: 20ug MCF7 cell lysates Lane 3: 20ug MCF7 cell lysates Lane 4: 20ug MCF7 cell lysates Lane 5: 20ug MCF7 with FoxA1 knockdown Lane 6: 20ug MCF7 with FoxA1 knockdownPrimary Antibody Dilution : 1:1000Secondary Antibody : Anti-rabbit-HRPSecondry Antibody Dilution : 1:2000Submitted by: Fu, Xiaoyong, Baylor College of MedicineFOXA1 is supported by BioGPS gene expression data to be expressed in MCF7)

WB (Western Blot)

(Host: MouseTarget Name: FOXA1Sample Tissue: Mouse LiverAntibody Dilution: 1ug/ml)

product-image-AAA23415_WB2.jpg WB (Western Blot) (Host: MouseTarget Name: FOXA1Sample Tissue: Mouse LiverAntibody Dilution: 1ug/ml)

IHC (Immunohistochemistry)

(Rabbit Anti-FOXA1 antibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult heartObserved Staining: Nuclei in adipocytes but not in cardiomyocytesPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy2/3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)

product-image-AAA23415_IHC.jpg IHC (Immunohistochemistry) (Rabbit Anti-FOXA1 antibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult heartObserved Staining: Nuclei in adipocytes but not in cardiomyocytesPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy2/3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)
Related Product Information for anti-FOXA1 antibody
This is a rabbit polyclonal antibody against FOXA1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: FOXA1 is a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver.This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49kDa
NCBI Official Full Name
hepatocyte nuclear factor 3-alpha
NCBI Official Synonym Full Names
forkhead box A1
NCBI Official Symbol
FOXA1
NCBI Official Synonym Symbols
HNF3A; TCF3A
NCBI Protein Information
hepatocyte nuclear factor 3-alpha

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The FOXA1 (Catalog #AAA23415) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FOXA1 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's FOXA1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the FOXA1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SFNHPFSINN LMSSSEQQHK LDFKAYEQAL QYSPYGSTLP ASLPLGSASV. It is sometimes possible for the material contained within the vial of "FOXA1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.