<
WB (Western Blot)
(FOXA1 monoclonal antibody (M03), clone 4F6 Western Blot analysis of FOXA1 expression in A-431.)
Mouse FOXA1 Monoclonal Antibody | anti-FOXA1 antibody
FOXA1 (Forkhead Box A1, HNF3A, MGC33105, TCF3A) (APC)
Gene Names
FOXA1; HNF3A; TCF3A
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified
Synonyms
FOXA1, Antibody; FOXA1 (Forkhead Box A1, HNF3A, MGC33105, TCF3A) (APC); Forkhead Box A1; HNF3A; MGC33105; TCF3A; anti-FOXA1 antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
4F6
Specificity
Recognizes FOXA1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-FOXA1 antibody
Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
FOXA1 (NP_004487, 367aa-472aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LASVPASHPAHGLAPHESQLHLKGDPHYSFNHPFSINNLMSSSEQQHKLDFKAYEQALQYSPYGSTLPASLPLGSASVTTRSPIEPSALEPAYYQGVYSRPVLNTS
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
WB (Western Blot)
(FOXA1 monoclonal antibody (M03), clone 4F6 Western Blot analysis of FOXA1 expression in A-431.)
WB (Western Blot)
(FOXA1 monoclonal antibody (M03), clone 4F6 Western Blot analysis of FOXA1 expression in A-431.)
WB (Western Blot)
(FOXA1 monoclonal antibody (M03), clone 4F6 Western Blot analysis of FOXA1 expression in HepG2.)
WB (Western Blot)
(FOXA1 monoclonal antibody (M03), clone 4F6 Western Blot analysis of FOXA1 expression in HepG2.)
IF (Immunofluorescence)
(Immunofluorescence of monoclonal antibody to FOXA1 on A-431 cell. [antibody concentration 10 ug/ml])
IF (Immunofluorescence)
(Immunofluorescence of monoclonal antibody to FOXA1 on A-431 cell. [antibody concentration 10 ug/ml])
IF (Immunofluorescence)
(Immunofluorescence of monoclonal antibody to FOXA1 on A-431 cell. [antibody concentration 10 ug/ml])
IF (Immunofluorescence)
(Immunofluorescence of monoclonal antibody to FOXA1 on A-431 cell. [antibody concentration 10 ug/ml])
IHC (Immunohistochemistry)
(Immunoperoxidase of monoclonal antibody to FOXA1 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml])
IHC (Immunohistochemistry)
(Immunoperoxidase of monoclonal antibody to FOXA1 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml])
Application Data
(Immunoperoxidase of monoclonal antibody to FOXA1 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml])
Application Data
(Immunoperoxidase of monoclonal antibody to FOXA1 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml])
Related Product Information for anti-FOXA1 antibody
This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. [provided by RefSeq]
Product Categories/Family for anti-FOXA1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
52 kDa
NCBI Official Full Name
hepatocyte nuclear factor 3-alpha
NCBI Official Synonym Full Names
forkhead box A1
NCBI Official Symbol
FOXA1
NCBI Official Synonym Symbols
HNF3A; TCF3A
NCBI Protein Information
hepatocyte nuclear factor 3-alpha; HNF-3A; TCF-3A; HNF-3-alpha; forkhead box protein A1; transcription factor 3A
UniProt Protein Name
Hepatocyte nuclear factor 3-alpha
UniProt Gene Name
FOXA1
UniProt Synonym Gene Names
HNF3A; TCF3A; HNF-3-alpha; HNF-3A; TCF-3A
UniProt Entry Name
FOXA1_HUMAN
Similar Products
Product Notes
The FOXA1 foxa1 (Catalog #AAA26090) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's FOXA1 can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FOXA1 foxa1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FOXA1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.