Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA330081_IHC13.jpg IHC (Immunohiostchemistry) (AAA330081 at 1/100 staining human colorectal cancer by IHC-P. The sample was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The sample was then blocked and incubated with the primary antibody at 4 degree C overnight. An HRP conjugated anti-mouse antibody was used as the secondary antibody.)

Mouse Galectin 3 Monoclonal Antibody | anti-LGALS3 antibody

Galectin 3 Mouse Monoclonal Antibody

Reactivity
Human, Mouse, Rat
Prediction: Pig, Horse, Rabbit, Dog
Applications
Immunohistochemistry, Western Blot
Purity
Affinity-chromatography.
Synonyms
Galectin 3, Antibody; Galectin 3 Mouse Monoclonal Antibody; 35 kDa lectin; Carbohydrate binding protein 35; Carbohydrate-binding protein 35; CBP 35; CBP35; Gal-3; GAL3; Galactose-specific lectin 3; Galactoside-binding protein; GALBP; Galectin 3 internal gene,included; Galectin-3; Galectin3; GALIG; GBP; IgE binding protein; IgE-binding protein; L 31; L 34; L-31; L-34 galactoside-binding lectin; L31; Laminin-binding protein; Lectin L-29; Lectin, galactose binding, soluble 3; LEG3_HUMAN; LGALS2; LGALS3; MAC 2 antigen; Mac-2; Mac-2 antigen; MAC2; Macrophage galactose-specific lectin; MGC105387; anti-LGALS3 antibody
Ordering
Host
Mouse
Reactivity
Human, Mouse, Rat
Prediction: Pig, Horse, Rabbit, Dog
Clonality
Monoclonal
Isotype
Mouse IgG1
Specificity
Galectin 3 Antibody detects endogenous levels of total Galectin 3.
Purity/Purification
Affinity-chromatography.
Form/Format
Mouse IgG1 in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Sequence
MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI
Applicable Applications for anti-LGALS3 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthesized peptide derived from human Galectin 3, corresponding to a region within the internal amino acids.
Conjugation
Unconjugated
Expression
A major expression is found in the colonic epithelium. It is also abundant in the activated macrophages. Expressed in fetal membranes.
Preparation and Storage
Store at -20 degree C. Stable for 12 months from date of receipt.

IHC (Immunohiostchemistry)

(AAA330081 at 1/100 staining human colorectal cancer by IHC-P. The sample was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The sample was then blocked and incubated with the primary antibody at 4 degree C overnight. An HRP conjugated anti-mouse antibody was used as the secondary antibody.)

product-image-AAA330081_IHC13.jpg IHC (Immunohiostchemistry) (AAA330081 at 1/100 staining human colorectal cancer by IHC-P. The sample was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The sample was then blocked and incubated with the primary antibody at 4 degree C overnight. An HRP conjugated anti-mouse antibody was used as the secondary antibody.)

WB (Western Blot)

(Western Blot analysis of extracts from various samples, using Galectin 3 Mouse Monoclonal Antibody. Lane 1: Hela cells treated with blocking-peptides, Lane 2: Hela cells, Lane 3: Rat lung tissue, Lane 4: 3T3-L1P6 cells.)

product-image-AAA330081_WB15.jpg WB (Western Blot) (Western Blot analysis of extracts from various samples, using Galectin 3 Mouse Monoclonal Antibody. Lane 1: Hela cells treated with blocking-peptides, Lane 2: Hela cells, Lane 3: Rat lung tissue, Lane 4: 3T3-L1P6 cells.)
Related Product Information for anti-LGALS3 antibody
galectin-3 galactose-specific lectin which binds IgE. Expressed at a high level in the colonic epithelium. Also abundant in activated macrophages.
Product Categories/Family for anti-LGALS3 antibody

NCBI and Uniprot Product Information

NCBI GeneID
UniProt Accession #
Molecular Weight
27kD; 26kD(Calculated)

Similar Products

Product Notes

The LGALS3 (Catalog #AAA330081) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Galectin 3 Mouse Monoclonal Antibody reacts with Human, Mouse, Rat Prediction: Pig, Horse, Rabbit, Dog and may cross-react with other species as described in the data sheet. AAA Biotech's Galectin 3 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the LGALS3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MADNFSLHDA LSGSGNPNPQ GWPGAWGNQP AGAGGYPGAS YPGAYPGQAP PGAYPGQAPP GAYPGAPGAY PGAPAPGVYP GPPSGPGAYP SSGQPSATGA YPATGPYGAP AGPLIVPYNL PLPGGVVPRM LITILGTVKP NANRIALDFQ RGNDVAFHFN PRFNENNRRV IVCNTKLDNN WGREERQSVF PFESGKPFKI QVLVEPDHFK VAVNDAHLLQ YNHRVKKLNE ISKLGISGDI DLTSASYTMI. It is sometimes possible for the material contained within the vial of "Galectin 3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.