Mouse anti-Human HCLS1 Monoclonal Antibody | anti-HCLS1 antibody

HCLS1 (Hematopoietic Lineage Cell-specific Protein, Hematopoietic Cell-specific LYN Substrate 1, LckBP1, p75, HS1) (Biotin)

Cat. Num. AAA24825

• Gene Names: HCLS1; HS1; p75; CTTNL; lckBP1
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: HCLS1, Antibody; HCLS1 (Hematopoietic Lineage Cell-specific Protein, Hematopoietic Cell-specific LYN Substrate 1, LckBP1, p75, HS1) (Biotin); anti-HCLS1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1A8
• Specificity: Recognizes human HCLS1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-HCLS1 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa266-355 from human HCLS1 (AAH16758) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: QERKAVTKRSPEAPQPVIAMEEPAVPAPLPKKISSEAWPPVGTPPSSESEPVRTSREHPVPLLPIRQTLPEDNEEPPALPPRTLEGLQVE
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Application Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between CASP3 and HCLS1. HeLa cells were stained with anti-CASP3 rabbit purified polyclonal 1:1200 and anti-HCLS1 mouse monoclonal antibody 1:50. Signals were detected by Duolink® 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

WB (Western Blot)

(Western blot analysis of HCLS1 over-expressed 293 cell line, cotransfected with HCLS1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with HCLS1 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)

Application Data

(Detection limit for recombinant GST tagged HCLS1 is ~0.1ng/ml as a capture antibody.)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to HCLS1 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3ug/ml])

WB (Western Blot)

(Western Blot analysis of HCLS1 expression in transfected 293T cell line by HCLS1 monoclonal antibody. Lane 1: HCLS1 transfected lysate (54kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(HCLS1 monoclonal antibody Western Blot analysis of HCLS1 expression in K-562.)

WB (Western Blot)

(Western Blot detection against Immunogen (35.64kD).)

Product Categories/Family for anti-HCLS1 antibody

Antibodies; Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 34782817
• NCBI GeneID: 3059
• Molecular Weight: 24,008 Da
• NCBI Official Full Name: Homo sapiens hematopoietic cell-specific Lyn substrate 1, mRNA
• NCBI Official Synonym Full Names: hematopoietic cell-specific Lyn substrate 1
• NCBI Official Symbol: HCLS1
• NCBI Official Synonym Symbols: HS1; p75; CTTNL; lckBP1
• NCBI Protein Information: hematopoietic lineage cell-specific protein