IHC (Immunohiostchemistry)
(Immunohistochemistry analysis of paraffin-embedded Human colon using HIF1?/ARNT Rabbit mAb (AAA282729) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.)
Rabbit anti-Human HIF1beta/ARNT Monoclonal Antibody | anti-ARNT antibody
HIF1beta/ARNT Rabbit mAb
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
HIF1beta/ARNT, Antibody; HIF1beta/ARNT Rabbit mAb; HIF1B; TANGO; bHLHe2; HIF1BETA; HIF-1beta; HIF1-beta; HIF-1-beta; HIF1beta/ARNT; anti-ARNT antibody
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
LAPRQQQQQTELDMVPGRDGLASYNHSQVVQPVTTTGPEHSKPLEKSDGLFAQDRDPRFSEIYHNINADQSKGISSSTVPATQQLFSQGNTFPPTPRPAENFRNSGLAPPVTIVQPSASAGQMLAQISRHSNPTQGATPTWTPTTRSGFSAQQVATQATAKTRTSQFGVGSFQTPSSFSSMSLPGAPTASPGAAAYPSLTNRGSNFAPETGQTAGQFQTRTAEGVGVWPQWQGQQPHHRSSSSEQHVQQPPAQQPGQPEVFQEMLSMLGDQSNSYNNEEFPDLTMFPPFSE
Applicable Applications for anti-ARNT antibody
ELISA, IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 499-789 of human HIF-1 beta (P27540).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
IHC (Immunohiostchemistry)
(Immunohistochemistry analysis of paraffin-embedded Human colon using HIF1?/ARNT Rabbit mAb (AAA282729) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.)
IHC (Immunohiostchemistry)
(Immunohistochemistry analysis of paraffin-embedded Human colon using HIF1?/ARNT Rabbit mAb (AAA282729) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.)
WB (Western Blot)
(Western blot analysis of lysates from HeLa cells, using HIF1?/ARNT Rabbit mAb (AAA282729) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)
WB (Western Blot)
(Western blot analysis of lysates from HeLa cells, using HIF1?/ARNT Rabbit mAb (AAA282729) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)
Related Product Information for anti-ARNT antibody
This gene encodes a protein containing a basic helix-loop-helix domain and two characteristic PAS domains along with a PAC domain. The encoded protein binds to ligand-bound aryl hydrocarbon receptor and aids in the movement of this complex to the nucleus, where it promotes the expression of genes involved in xenobiotic metabolism. This protein is also a co-factor for transcriptional regulation by hypoxia-inducible factor 1. Chromosomal translocation of this locus with the ETV6 (ets variant 6) gene on chromosome 12 have been described in leukemias. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-ARNT antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated MW: 87kDa
Observed MW: 87kDa
Observed MW: 87kDa
UniProt Protein Name
Aryl hydrocarbon receptor nuclear translocator
UniProt Gene Name
ARNT
UniProt Synonym Gene Names
BHLHE2; ARNT protein; bHLHe2; HIF-1-beta; HIF1-beta
UniProt Entry Name
ARNT_HUMAN
Similar Products
Product Notes
The ARNT arnt (Catalog #AAA282729) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HIF1beta/ARNT Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HIF1beta/ARNT can be used in a range of immunoassay formats including, but not limited to, ELISA, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the ARNT arnt for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LAPRQQQQQT ELDMVPGRDG LASYNHSQVV QPVTTTGPEH SKPLEKSDGL FAQDRDPRFS EIYHNINADQ SKGISSSTVP ATQQLFSQGN TFPPTPRPAE NFRNSGLAPP VTIVQPSASA GQMLAQISRH SNPTQGATPT WTPTTRSGFS AQQVATQATA KTRTSQFGVG SFQTPSSFSS MSLPGAPTAS PGAAAYPSLT NRGSNFAPET GQTAGQFQTR TAEGVGVWPQ WQGQQPHHRS SSSEQHVQQP PAQQPGQPEV FQEMLSMLGD QSNSYNNEEF PDLTMFPPFS E. It is sometimes possible for the material contained within the vial of "HIF1beta/ARNT, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.