FCM/FACS (Flow Cytometry)
(Figure 3. Flow Cytometry analysis of U20S cells using anti- Hsp70 antibody (M00949-2).Overlay histogram showing U20S cells stained with M00949-2 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with mouse anti- Hsp70 Antibody (M00949-2, 1ug/1x106 cells) for 30 min at 20 degree C. DyLight® 488 conjugated goat anti-mouse IgG (BA1126, 5-10ug/1x106 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was mouse IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)
Mouse Hsp70 Monoclonal Antibody | anti-Hsp70 antibody
Anti-Hsp70 Antibody (monoclonal, 3H5)
Gene Names
HSPA1A; HSP72; HSPA1; HSP70I; HSP70-1; HSP70-2; HSP70.1; HSP70.2; HSP70-1A; HEL-S-103
Reactivity
Human, Mouse, Rat
Applications
Flow Cytometry, Functional Assay, Immunocytochemistry, Immunohistochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
Hsp70, Antibody; Anti-Hsp70 Antibody (monoclonal, 3H5); Heat shock 70 kDa protein 1A; Heat shock 70 kDa protein 1B; Heat shock 70 kDa protein 1A/1B; Heat shock protein family A (Hsp70) member 1A/1B; anti-Hsp70 antibody
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG1
Clone Number
3H5
Specificity
No cross reactivity with other proteins.
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized
Sequence Length
586
Applicable Applications for anti-Hsp70 antibody
FCM/FACS (Flow Cytometry), ICC (Immunocytochemistry), IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Hsp70 (559-596aa KGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKR), different from the related mouse sequence by five amino acids, and from the related rat sequence by three amino acids.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Relevant Detection Systems
It is recommended to use an Enhanced Chemiluminescent Kit with anti-Rabbit IgG (MBS176460) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (MBS176453) for IHC-P, IHC-F and ICC.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time.
Avoid repeated freezing and thawing.
Avoid repeated freezing and thawing.
FCM/FACS (Flow Cytometry)
(Figure 3. Flow Cytometry analysis of U20S cells using anti- Hsp70 antibody (M00949-2).Overlay histogram showing U20S cells stained with M00949-2 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with mouse anti- Hsp70 Antibody (M00949-2, 1ug/1x106 cells) for 30 min at 20 degree C. DyLight® 488 conjugated goat anti-mouse IgG (BA1126, 5-10ug/1x106 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was mouse IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)
FCM/FACS (Flow Cytometry)
(Figure 3. Flow Cytometry analysis of U20S cells using anti- Hsp70 antibody (M00949-2).Overlay histogram showing U20S cells stained with M00949-2 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with mouse anti- Hsp70 Antibody (M00949-2, 1ug/1x106 cells) for 30 min at 20 degree C. DyLight® 488 conjugated goat anti-mouse IgG (BA1126, 5-10ug/1x106 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was mouse IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)
FCM/FACS (Flow Cytometry)
(Figure 3. Flow Cytometry analysis of U20S cells using anti- Hsp70 antibody (M00949-2).Overlay histogram showing U20S cells stained with M00949-2 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with mouse anti- Hsp70 Antibody (M00949-2, 1ug/1x106 cells) for 30 min at 20 degree C. DyLight® 488 conjugated goat anti-mouse IgG (BA1126, 5-10ug/1x106 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was mouse IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)
FCM/FACS (Flow Cytometry)
(Figure 3. Flow Cytometry analysis of U20S cells using anti- Hsp70 antibody (M00949-2).Overlay histogram showing U20S cells stained with M00949-2 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with mouse anti- Hsp70 Antibody (M00949-2, 1ug/1x106 cells) for 30 min at 20 degree C. DyLight® 488 conjugated goat anti-mouse IgG (BA1126, 5-10ug/1x106 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was mouse IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)
IHC (Immunohistochemistry)
(Figure 1. IHC analysis of Hsp70 using anti-Hsp70 antibody (M00949-2).Hsp70 was detected in paraffin-embedded section of human lung cancer tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2ug/ml mouse anti-Hsp70 Antibody (M00949-2) overnight at 4 degree C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)
IHC (Immunohistochemistry)
(Figure 1. IHC analysis of Hsp70 using anti-Hsp70 antibody (M00949-2).Hsp70 was detected in paraffin-embedded section of human lung cancer tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2ug/ml mouse anti-Hsp70 Antibody (M00949-2) overnight at 4 degree C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)
Related Product Information for anti-Hsp70 antibody
Description: Mouse IgG monoclonal antibody for Hsp70 detection. Tested with WB, IHC-P, IHC-F, ICC, FCM in Human; Mouse; Rat.
Background: HSPA1 (heat shock 70kDa protein 1A) also known as HSP70-1, HSPA1A, HSP70-1A, HSP72 or HSP70I, is a protein that in humans is encoded by the HSPA1A gene. This intronless gene encodes a 70kDa heat shock protein which is a member of the heat shock protein 70 family. The HSPA1A gene encodes a predicted 641-amino acid protein. The HSPA1 gene is mapped on 6p21.33. Shimizu et al. (1999) found that peripheral blood mononuclear cells of 18 major depression patients expressed a short HSPA1A transcript that utilized exon 1 rather than exon 2, which is found in the more common HSPA1A transcript. No protein was associated with expression of this short HSPA1A mRNA, possibly due to lack of a TATA box or loss of internal ribosome binding sites. Treatment with BGP-15, a pharmacologic inducer of Hsp72 that can protect against obesity-induced insulin resistance, improved muscular architecture, strength, and contractile function in severely affected diaphragm muscles in mdx dystrophic mice.
Background: HSPA1 (heat shock 70kDa protein 1A) also known as HSP70-1, HSPA1A, HSP70-1A, HSP72 or HSP70I, is a protein that in humans is encoded by the HSPA1A gene. This intronless gene encodes a 70kDa heat shock protein which is a member of the heat shock protein 70 family. The HSPA1A gene encodes a predicted 641-amino acid protein. The HSPA1 gene is mapped on 6p21.33. Shimizu et al. (1999) found that peripheral blood mononuclear cells of 18 major depression patients expressed a short HSPA1A transcript that utilized exon 1 rather than exon 2, which is found in the more common HSPA1A transcript. No protein was associated with expression of this short HSPA1A mRNA, possibly due to lack of a TATA box or loss of internal ribosome binding sites. Treatment with BGP-15, a pharmacologic inducer of Hsp72 that can protect against obesity-induced insulin resistance, improved muscular architecture, strength, and contractile function in severely affected diaphragm muscles in mdx dystrophic mice.
References
1. Becker, T., Hartl, F.-U., Wieland, F. CD40, an extracellular receptor for binding and uptake of Hsp70-peptide complexes. J. Cell Biol. 158: 1277-1285, 2002. 2. Gehrig, S. M., van der Poel, C., Sayer, T. A., Schertzer, J. D., Henstridge, D. C., Church, J. E., Lamon, S., Russell, A. P., Davies, K. E., Febbraio, M. A., Lynch, G. S. Hsp72 preserves muscle function and slows progression of severe muscular dystrophy. Nature 484: 394-398, 2012. 3. Shimizu, S., Nomura, K., Ujihara, M., Demura, H. An additional exon of stress-inducible heat shock protein 70 gene (HSP70-1). Biochem. Biophys. Res. Commun. 257: 193-198, 1999.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
63,937 Da
NCBI Official Full Name
heat shock 70 kDa protein 1A
NCBI Official Synonym Full Names
heat shock protein family A (Hsp70) member 1A
NCBI Official Symbol
HSPA1A
NCBI Official Synonym Symbols
HSP72; HSPA1; HSP70I; HSP70-1; HSP70-2; HSP70.1; HSP70.2; HSP70-1A; HEL-S-103
NCBI Protein Information
heat shock 70 kDa protein 1A
UniProt Protein Name
Heat shock 70 kDa protein 1A
UniProt Gene Name
HSPA1A
UniProt Synonym Gene Names
HSP721 PublicationManual assertion based on opinion iniRef.41; HSP70-12 PublicationsManual assertion based on opinion iniRef.4; HSP70.1
Similar Products
Product Notes
The Hsp70 hspa1a (Catalog #AAA125136) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Anti-Hsp70 Antibody (monoclonal, 3H5) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Hsp70 can be used in a range of immunoassay formats including, but not limited to, FCM/FACS (Flow Cytometry), ICC (Immunocytochemistry), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the Hsp70 hspa1a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Hsp70, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.