Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA19359_FCM7.png FCM (Flow Cytometry) (Figure 7. Flow Cytometry analysis of A549 cells using anti-Hsp90 alpha antibody (AAA19359).Overlay histogram showing A549 cells stained with AAA19359 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with mouse anti-Hsp90 alpha Antibody (AAA19359, 1μg/1x106 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-mouse IgG (BA1126, 5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was mouse IgG (1μg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

Mouse Hsp90 alpha Monoclonal Antibody | anti-HSP90AA1 antibody

Anti-Hsp90 alpha Antibody (monoclonal, 6B5)

Gene Names
HSP90AA1; EL52; HSPN; LAP2; HSP86; HSPC1; HSPCA; Hsp89; Hsp90; HSP89A; HSP90A; HSP90N; HSPCAL1; HSPCAL4
Reactivity
Human, Mouse, Rat, Monkey
Applications
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Flow Cytometry, Functional Assay
Purity
Immunogen affinity purified.
Synonyms
Hsp90 alpha, Antibody; Anti-Hsp90 alpha Antibody (monoclonal, 6B5); HSP90AA1; HSP90A; HSPC1; HSPCA; Heat shock protein HSP 90-alpha; Heat shock 86 kDa; HSP 86; HSP86; Lipopolysaccharide-associated protein 2; LAP-2; LPS-associated protein 2; Renal carcinoma antigen NY-REN-38; heat shock protein 90kDa alpha (cytosolic), class A member 1; anti-HSP90AA1 antibody
Ordering
Host
Mouse
Reactivity
Human, Mouse, Rat, Monkey
Clonality
Monoclonal
Isotype
Mouse IgG2b
Clone Number
6B5
Specificity
Mouse IgG monoclonal antibody for Hsp90 alpha detection.
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized. Each vial contains 4mg Trehalose, 0.9mg NaCl and 0.2mg Na2HPO4.
Applicable Applications for anti-HSP90AA1 antibody
WB (Western Blot), IHC (Immunohistochemistry), ICC (Immunocytochemistry), IF (Immunofluorescence), FCM/FACS (Flow Cytometry)
Application Notes
WB: 0.25-0.5ug/ml|Human, Mouse, Rat, Monkey|
IHC-P: 2-5ug/ml|Human|
ICC/IF: 5ug/ml|Human|
FC/FACS/FCM: 1-3ug/1x106 cells|Human|
Immunogen
E Coli-derived human PTBP2 recombinant protein (Position: M1-A504). A synthetic peptide corresponding to a sequence at the C-terminus of human Hsp90 alpha (454-488aa QNRKKLSELLRYYTSASGDEMVSLKDYCTRMKENQ), identical to the related mouse and rat sequences.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Recommended Detection Systems
Recommended Detection Systems
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

FCM (Flow Cytometry)

(Figure 7. Flow Cytometry analysis of A549 cells using anti-Hsp90 alpha antibody (AAA19359).Overlay histogram showing A549 cells stained with AAA19359 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with mouse anti-Hsp90 alpha Antibody (AAA19359, 1μg/1x106 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-mouse IgG (BA1126, 5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was mouse IgG (1μg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

product-image-AAA19359_FCM7.png FCM (Flow Cytometry) (Figure 7. Flow Cytometry analysis of A549 cells using anti-Hsp90 alpha antibody (AAA19359).Overlay histogram showing A549 cells stained with AAA19359 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with mouse anti-Hsp90 alpha Antibody (AAA19359, 1μg/1x106 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-mouse IgG (BA1126, 5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was mouse IgG (1μg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

IF (Immunofluorescence)

(Figure 6. IF analysis of Hsp90 alpha using anti- Hsp90 alpha antibody (AAA19359).Hsp90 alpha was detected in immunocytochemical section of SiHa cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 5μg/mL mouse anti- Hsp90 alpha Antibody (AAA19359) overnight at 4 degree C. DyLight®488 Conjugated Goat Anti-Mouse IgG (BA1126) was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37 degree C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.)

product-image-AAA19359_IF6.jpg IF (Immunofluorescence) (Figure 6. IF analysis of Hsp90 alpha using anti- Hsp90 alpha antibody (AAA19359).Hsp90 alpha was detected in immunocytochemical section of SiHa cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 5μg/mL mouse anti- Hsp90 alpha Antibody (AAA19359) overnight at 4 degree C. DyLight®488 Conjugated Goat Anti-Mouse IgG (BA1126) was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37 degree C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.)

IHC (Immunohistochemistry)

(Figure 5. IHC analysis of Hsp90 alpha using anti-Hsp90 alpha antibody (AAA19359).Hsp90 alpha was detected in paraffin-embedded section of human testis cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml mouse anti-Hsp90 alpha Antibody (AAA19359) overnight at 4 degree C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.)

product-image-AAA19359_IHC5.jpg IHC (Immunohistochemistry) (Figure 5. IHC analysis of Hsp90 alpha using anti-Hsp90 alpha antibody (AAA19359).Hsp90 alpha was detected in paraffin-embedded section of human testis cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml mouse anti-Hsp90 alpha Antibody (AAA19359) overnight at 4 degree C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.)

IHC (Immunohistochemistry)

(Figure 4. IHC analysis of Hsp90 alpha using anti-Hsp90 alpha antibody (AAA19359).Hsp90 alpha was detected in paraffin-embedded section of human lung cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml mouse anti-Hsp90 alpha Antibody (AAA19359) overnight at 4 degree C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.)

product-image-AAA19359_IHC4.jpg IHC (Immunohistochemistry) (Figure 4. IHC analysis of Hsp90 alpha using anti-Hsp90 alpha antibody (AAA19359).Hsp90 alpha was detected in paraffin-embedded section of human lung cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml mouse anti-Hsp90 alpha Antibody (AAA19359) overnight at 4 degree C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.)

IHC (Immunohistochemistry)

(Figure 3. IHC analysis of Hsp90 alpha using anti-Hsp90 alpha antibody (AAA19359).Hsp90 alpha was detected in paraffin-embedded section of human colon cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml mouse anti-Hsp90 alpha Antibody (AAA19359) overnight at 4 degree C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.)

product-image-AAA19359_IHC3.jpg IHC (Immunohistochemistry) (Figure 3. IHC analysis of Hsp90 alpha using anti-Hsp90 alpha antibody (AAA19359).Hsp90 alpha was detected in paraffin-embedded section of human colon cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml mouse anti-Hsp90 alpha Antibody (AAA19359) overnight at 4 degree C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.)

IHC (Immunohistochemistry)

(Figure 2. IHC analysis of Hsp90 alpha using anti-Hsp90 alpha antibody (AAA19359).Hsp90 alpha was detected in paraffin-embedded section of human cervical cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml mouse anti-Hsp90 alpha Antibody (AAA19359) overnight at 4 degree C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.)

product-image-AAA19359_IHC2.jpg IHC (Immunohistochemistry) (Figure 2. IHC analysis of Hsp90 alpha using anti-Hsp90 alpha antibody (AAA19359).Hsp90 alpha was detected in paraffin-embedded section of human cervical cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml mouse anti-Hsp90 alpha Antibody (AAA19359) overnight at 4 degree C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # with DAB as the chromogen.)

WB (Western Blot)

(Figure 1. Western blot analysis of Hsp90 alpha using anti-Hsp90 alpha antibody (AAA19359).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30ug of sample under reducing conditions.Lane 1: human Hela whole cell lysatesLane 2: human HEK293 whole cell lysatesLane 3: monkey COS-7 whole cell lysatesLane 4: human HepG2 whole cell lysatesLane 5: human A549 whole cell lysatesLane 6: rat PC-12 whole cell lysatesLane 7: rat RH35 whole cell lysatesLane 8: mouse HEPA1-6 whole cell lysates.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1. 5 hour at RT. The membrane was incubated with mouse anti- Hsp90 alpha antigen affinity purified monoclonal antibody (Catalog # AAA19359) at 0. 5 μg/mL overnight at 4 degree C, then washed with TBS-0. 1%Tween 3 times with 5 minutes each and probed with a goat anti-mouse IgG-HRP secondary antibody at a dilution of 1:10000 for 1. 5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # with Tanon 5200 system. A specific band was detected for Hsp90 alpha at approximately 90KD. The expected band size for Hsp90 alpha is at 90KD.)

product-image-AAA19359_WB.jpg WB (Western Blot) (Figure 1. Western blot analysis of Hsp90 alpha using anti-Hsp90 alpha antibody (AAA19359).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30ug of sample under reducing conditions.Lane 1: human Hela whole cell lysatesLane 2: human HEK293 whole cell lysatesLane 3: monkey COS-7 whole cell lysatesLane 4: human HepG2 whole cell lysatesLane 5: human A549 whole cell lysatesLane 6: rat PC-12 whole cell lysatesLane 7: rat RH35 whole cell lysatesLane 8: mouse HEPA1-6 whole cell lysates.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1. 5 hour at RT. The membrane was incubated with mouse anti- Hsp90 alpha antigen affinity purified monoclonal antibody (Catalog # AAA19359) at 0. 5 μg/mL overnight at 4 degree C, then washed with TBS-0. 1%Tween 3 times with 5 minutes each and probed with a goat anti-mouse IgG-HRP secondary antibody at a dilution of 1:10000 for 1. 5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # with Tanon 5200 system. A specific band was detected for Hsp90 alpha at approximately 90KD. The expected band size for Hsp90 alpha is at 90KD.)
Related Product Information for anti-HSP90AA1 antibody
Heat shock protein HSP 90-alpha is a protein that in humans is encoded by the HSP90AA1 gene. The gene, HSP90AA1, encodes the human stress-inducible 90-kDa heat shock protein alpha (Hsp90A). Complemented by the constitutively expressed paralog Hsp90B which shares over 85% amino acid sequence identity, Hsp90A expression is initiated when a cell experiences proteotoxic stress. Once expressed Hsp90A dimers operate as molecular chaperones that bind and fold other proteins into their functional 3-dimensional structures. This molecular chaperoning ability of Hsp90A is driven by a cycle of structural rearrangements fueled by ATP hydrolysis. Current research on Hsp90A focuses in its role as a drug target due to its interaction with a large number of tumor promoting proteins and its role in cellular stress adaptation.
References
1. Chen B, Piel WH, Gui L, Bruford E, Monteiro A (Dec 2005). "The HSP90 family of genes in the human genome: insights into their divergence and evolution". Genomics86 (6): 627-37.
2. Hickey E, Brandon SE, Smale G, Lloyd D, Weber LA (Jun 1989). "Sequence and regulation of a gene encoding a human 89-kilodalton heat shock protein". Molecular and Cellular Biology 9 (6): 2615-26.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
84,660 Da
NCBI Official Full Name
heat shock protein HSP 90-alpha isoform 1
NCBI Official Synonym Full Names
heat shock protein 90kDa alpha (cytosolic), class A member 1
NCBI Official Symbol
HSP90AA1
NCBI Official Synonym Symbols
EL52; HSPN; LAP2; HSP86; HSPC1; HSPCA; Hsp89; Hsp90; HSP89A; HSP90A; HSP90N; HSPCAL1; HSPCAL4
NCBI Protein Information
heat shock protein HSP 90-alpha; HSP 86; heat shock 86 kDa; heat shock 90kD protein 1, alpha; heat shock 90kDa protein 1, alpha; renal carcinoma antigen NY-REN-38; heat shock 90kD protein, alpha-like 4; epididymis luminal secretory protein 52; heat shock
UniProt Protein Name
Heat shock protein HSP 90-alpha
UniProt Gene Name
HSP90AA1
UniProt Synonym Gene Names
HSP90A; HSPC1; HSPCA; HSP 86; HSP86
UniProt Entry Name
HS90A_HUMAN

Similar Products

Product Notes

The HSP90AA1 hsp90aa1 (Catalog #AAA19359) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Anti-Hsp90 alpha Antibody (monoclonal, 6B5) reacts with Human, Mouse, Rat, Monkey and may cross-react with other species as described in the data sheet. AAA Biotech's Hsp90 alpha can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry), ICC (Immunocytochemistry), IF (Immunofluorescence), FCM/FACS (Flow Cytometry). WB: 0.25-0.5ug/ml|Human, Mouse, Rat, Monkey| IHC-P: 2-5ug/ml|Human| ICC/IF: 5ug/ml|Human| FC/FACS/FCM: 1-3ug/1x106 cells|Human|. Researchers should empirically determine the suitability of the HSP90AA1 hsp90aa1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Hsp90 alpha, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.