Mouse anti-Human Integrin alpha 3A Monoclonal Antibody | anti-Itga3 antibody
Mouse anti Integrin alpha 3A
Gene Names
Itga3; CD49C; GAPB3; AA407068
Reactivity
Human
Applications
Western Blot, Immunohistochemistry, Immunocytochemistry
Synonyms
Integrin alpha 3A, Antibody; Mouse anti Integrin alpha 3A; anti-Itga3 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a
Clone Number
158A3
Specificity
158A3 reacts exclusively with the cytoplasmic domain of non-phosphorylated integrin subunit a3A.
Form/Format
Each vial contains 100 ul of 1 mg/ml purified monoclonal antibody in PBS containing 0.09% sodium azide.
Applicable Applications for anti-Itga3 antibody
WB (Western Blot), IHC (Immunohistochemistry), ICC (Immunocytochemistry)
Source Note
158A3 is a Mouse monoclonal IgG2a antibody derived by fusion of SP2/0 Mouse myeloma cells with spleen cells from a BALB/c Mouse immunized with a synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit alpha3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin.
Preparation and Storage
Store at 4 degree C, or in small aliquots at -20 degree C.
Related Product Information for anti-Itga3 antibody
Integrins are a family of heterodimeric membrane glycoproteins consisting of non-covalently associated alpha and beta subunits. More than 18 alpha and 8 beta subunits with numerous splice variant isoforms have been identified in mammals. In general, integrins function as receptors for extracellular matrix proteins. Certain integrins can also bind to soluble ligands or to counter-receptors on adjacent cells, such as the intracellular adhesion molecules (ICAMs), resulting in aggregation of cells. Signals transduced by integrins play a role in many biological processes, including cell growth, differentiation, migRation and apoptosis. For integrin subunits alpha3 and alpha6, two cytoplasmic variants, A and B, have been identified.
Product Categories/Family for anti-Itga3 antibody
References
Delwel, G. O., de Melker, A. A., Hogervorst, F., Jaspars, L. H., Fles, D. L., Kuikman, I., Lindblom, A., Paulsson, M., Timpl, R., and Sonnenberg, A. (1994). Distinct and overlapping ligand specificities of the alpha 3A beta 1 and alpha 6A beta 1 integrins: recognition of laminin isoforms, Mol Biol Cell 5, 203-15. de Melker, A. A., Sterk, L. M., Delwel, G. O., Fles, D. L., Daams, H., Weening, J. J., and Sonnenberg, A. (1997). The A and B variants of the alpha 3 integrin subunit: tissue distribution and functional characterization, Lab Invest 76, 547-63.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
116,745 Da
NCBI Official Full Name
integrin alpha 3A
NCBI Official Synonym Full Names
integrin alpha 3
NCBI Official Symbol
Itga3
NCBI Official Synonym Symbols
CD49C; GAPB3; AA407068
NCBI Protein Information
integrin alpha-3; VLA-3 alpha 3; alpha3-integrin; galactoprotein B3; VLA-3 subunit alpha; VLA-3 receptor, alpha 3 subunit; CD49 antigen-like family member C
UniProt Protein Name
Integrin alpha-3
UniProt Gene Name
Itga3
UniProt Synonym Gene Names
GAPB3
UniProt Entry Name
ITA3_MOUSE
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The Itga3 itga3 (Catalog #AAA77475) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Mouse anti Integrin alpha 3A reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Integrin alpha 3A can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry), ICC (Immunocytochemistry). Researchers should empirically determine the suitability of the Itga3 itga3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Integrin alpha 3A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
