SDS-PAGE
(SDS-Page analysis of recombinant human Wnt3a. Sample was loaded in 15% SDS-polyacrylamide gel under reducing condition and stained with Coomassie blue.)
Wnt-3a recombinant protein
Human Wnt-3a
Purity
>90% by SDS-PAGE & Coomassie stain
Synonyms
Wnt-3a; N/A; Human Wnt-3a; Wnt-3a recombinant protein
Host
E Coli
Purity/Purification
>90% by SDS-PAGE & Coomassie stain
Form/Format
Lyophilized
Sequence
Protein Sequence: MSYPIWWSLAVGPQYSSLGSQPILCASIPGLVPKQLRFCRNYVEIMPSVA EGIKIGIQECQHQFRGRRWNCTTVHDSLAIFGPVLDKATRESAFVHAIAS AGVAFAVTRSCAEGTAAICGHMHLKCKCHGLSGSCEVKTCWWSQPDFRAIGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEAS PNFCEPNPETGSFGTRDRTCNVSSHGIDGCDLLCCGRGHNARAERRREKCRCVFHWCCYVSCQECTRVYDVHTCKLEHHHHHH
Sequence Length
352
Stabilizer
None
Stability
The lyophilized human Wnt3a, though stable at room temperature, is best stored desiccated below 0°C. Reconstituted human Wnt3a should be stored in working aliquots at -20°C.
Reconstitution
Human Wnt3a should be reconstituted in 50 mM acetic acid to a concentration of 0.1 mg/ml. This is solution can be diluted in water or other buffer solutions or stored at -20°C.
Buffer
50mM acetic acid
Length (aa)
343
SDS-PAGE
(SDS-Page analysis of recombinant human Wnt3a. Sample was loaded in 15% SDS-polyacrylamide gel under reducing condition and stained with Coomassie blue.)
SDS-PAGE
(SDS-Page analysis of recombinant human Wnt3a. Sample was loaded in 15% SDS-polyacrylamide gel under reducing condition and stained with Coomassie blue.)
Related Product Information for Wnt-3a recombinant protein
Wnt-3a is one of about 19 vertebrate members of the Wingless-type MMTV integration site (Wnt) family of highly conserved, cysteine-rich secreted glycoproteins important for normal developmental processes. Wnts bind to receptors of the Frizzled family in conjunction with a coreceptor of the low-density lipoprotein receptor-related protein family (LRP-5 or -6), or the Ryk atypical receptor tyrosine kinase. During development, Wnt-3a is a morphogen that is thought to coordinate somitogenesis and mesoderm boundary determination. When Wnt-3a is deleted, mice fail to develop a hippocampus, and show defects in anterior-posterior patterning, somite development and tailbud formation. Wnt-3a has also been implicated in chondrocyte differentiation. Like other Wnts, Wnt-3a is modified by palmitate addition (at Cys 77) following glycosylation, which increases its hydrophobicity, secretion and activity. A second site at Ser 209 modified by palmitoleic acid also contributes. Human Wnt-3a shares 96% amino acid (aa) identity with mouse, bovine and canine Wnt-3a, and 89%, 86% and 84% aa identity with chicken, Xenopus and zebrafish Wnt-3a, respectively. It also shares 87% aa identity with Wnt-3. Human Wnt-3a is a 44 kDa secreted hydrophobic glycoprotein containing a conserved pattern of 24 cysteine residues.
Product Categories/Family for Wnt-3a recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
38.6 kDa
NCBI Official Full Name
protein Wnt-3a
NCBI Official Synonym Full Names
wingless-type MMTV integration site family, member 3A
NCBI Official Symbol
WNT3A
NCBI Protein Information
protein Wnt-3a
UniProt Protein Name
Protein Wnt-3a
UniProt Gene Name
WNT3A
UniProt Entry Name
WNT3A_HUMAN
Similar Products
Product Notes
The Wnt-3a wnt3a (Catalog #AAA79316) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: Protein Sequence: MSYPIWWSLA VGPQYSSLGS QPILCASIPG LVPKQLRFCR NYVEIMPSVA EGIKIGIQEC QHQFRGRRWN CTTVHDSLAI FGPVLDKATR ESAFVHAIAS AGVAFAVTRS CAEGTAAICG HMHLKCKCHG LSGSCEVKTC WWSQPDFRAI GDFLKDKYDS ASEMVVEKHR ESRGWVETLR PRYTYFKVPT ERDLVYYEAS PNFCEPNPET GSFGTRDRTC NVSSHGIDGC DLLCCGRGHN ARAERRREKC RCVFHWCCYV SCQECTRVYD VHTCKLEHHH HHH. It is sometimes possible for the material contained within the vial of "Wnt-3a, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.