Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA28480_FCM12.jpg FCM (Flow Cytometry) (Flow cytometry:1X10^6 Daudi cells (negative control,left) and U-251MG cells (right) were intracellularly-stained with Integrin alpha V (ITGAV/CD51) Rabbit mAb(AAA28480, 2.5 ug/mL,orange line) or Rabbit IgG isotype control (AC042, 2.5 ug/mL,blue line),followed by FITC conjugated goat anti-rabbit pAb(1:200 dilution) staining. Non-fluorescently stained cells were used as blank control (red line).)

Rabbit anti-Human Integrin alpha V (ITGAV/CD51) Monoclonal Antibody | anti-ITGAV antibody

Integrin alpha V (ITGAV/CD51) Rabbit mAb

Reactivity
Human
Applications
Western Blot, Immunohistochemistry, Flow Cytometry, Functional Assay, ELISA
Purity
Affinity purification
Synonyms
Integrin alpha V (ITGAV/CD51), Antibody; Integrin alpha V (ITGAV/CD51) Rabbit mAb; CD51; MSK8; VNRA; VTNR; Integrin alpha V (ITGAV/CD51); anti-ITGAV antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
SLKSSASFNVIEFPYKNLPIEDITNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENGEGNSET
Applicable Applications for anti-ITGAV antibody
WB (Western Blot), IHC (Immunohistochemistry), FCM/FACS (Flow Cytometry), ELISA
Application Notes
WB: 1:1000-1:6000
IHC-P: 1:1000-1:4000
FC (intra): 1:50-1:200
ELISA: Recommended starting concentration is 1ug/mL.
Please optimize the concentration based on your specific assay requirements.
Cross Reactivity
Human, Mouse, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 949-1048 of human Integrin alpha V (ITGAV/CD51)(NP_002201.2).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

FCM (Flow Cytometry)

(Flow cytometry:1X10^6 Daudi cells (negative control,left) and U-251MG cells (right) were intracellularly-stained with Integrin alpha V (ITGAV/CD51) Rabbit mAb(AAA28480, 2.5 ug/mL,orange line) or Rabbit IgG isotype control (AC042, 2.5 ug/mL,blue line),followed by FITC conjugated goat anti-rabbit pAb(1:200 dilution) staining. Non-fluorescently stained cells were used as blank control (red line).)

product-image-AAA28480_FCM12.jpg FCM (Flow Cytometry) (Flow cytometry:1X10^6 Daudi cells (negative control,left) and U-251MG cells (right) were intracellularly-stained with Integrin alpha V (ITGAV/CD51) Rabbit mAb(AAA28480, 2.5 ug/mL,orange line) or Rabbit IgG isotype control (AC042, 2.5 ug/mL,blue line),followed by FITC conjugated goat anti-rabbit pAb(1:200 dilution) staining. Non-fluorescently stained cells were used as blank control (red line).)

FCM (Flow Cytometry)

(Flow cytometry:1X10^6 Daudi cells cells (negative control,left) and BEWO cells (right) were intracellularly-stained with Integrin alpha V (ITGAV/CD51) Rabbit mAb(AAA28480, 2.5 ug/mL,orange line) or Rabbit IgG isotype control (AC042, 2.5 ug/mL,blue line),followed by FITC conjugated goat anti-rabbit pAb(1:200 dilution) staining. Non-fluorescently stained cells were used as blank control (red line).)

product-image-AAA28480_FCM11.jpg FCM (Flow Cytometry) (Flow cytometry:1X10^6 Daudi cells cells (negative control,left) and BEWO cells (right) were intracellularly-stained with Integrin alpha V (ITGAV/CD51) Rabbit mAb(AAA28480, 2.5 ug/mL,orange line) or Rabbit IgG isotype control (AC042, 2.5 ug/mL,blue line),followed by FITC conjugated goat anti-rabbit pAb(1:200 dilution) staining. Non-fluorescently stained cells were used as blank control (red line).)

FCM (Flow Cytometry)

(Flow cytometry:1X10^6 Daudi cells (negative control,left) and HUVEC cells (right) were intracellularly-stained with Integrin alpha V (ITGAV/CD51) Rabbit mAb(AAA28480, 2.5 ug/mL,orange line) or Rabbit IgG isotype control (AC042, 2.5 ug/mL,blue line),followed by FITC conjugated goat anti-rabbit pAb(1:200 dilution) staining. Non-fluorescently stained cells were used as blank control (red line).)

product-image-AAA28480_FCM10.jpg FCM (Flow Cytometry) (Flow cytometry:1X10^6 Daudi cells (negative control,left) and HUVEC cells (right) were intracellularly-stained with Integrin alpha V (ITGAV/CD51) Rabbit mAb(AAA28480, 2.5 ug/mL,orange line) or Rabbit IgG isotype control (AC042, 2.5 ug/mL,blue line),followed by FITC conjugated goat anti-rabbit pAb(1:200 dilution) staining. Non-fluorescently stained cells were used as blank control (red line).)

IHC (Immunohistchemistry)

(Immunohistochemistry analysis of paraffin-embedded Rat spleen tissue using Integrin alpha V (ITGAV/CD51) Rabbit mAb (AAA28480) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

product-image-AAA28480_IHC9.jpg IHC (Immunohistchemistry) (Immunohistochemistry analysis of paraffin-embedded Rat spleen tissue using Integrin alpha V (ITGAV/CD51) Rabbit mAb (AAA28480) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Rat liver tissue using Integrin alpha V (ITGAV/CD51) Rabbit mAb (AAA28480) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

product-image-AAA28480_IHC8.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Rat liver tissue using Integrin alpha V (ITGAV/CD51) Rabbit mAb (AAA28480) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using Integrin alpha V (ITGAV/CD51) Rabbit mAb (AAA28480) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

product-image-AAA28480_IHC7.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using Integrin alpha V (ITGAV/CD51) Rabbit mAb (AAA28480) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

IHC (Immunohistchemistry)

(Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using Integrin alpha V (ITGAV/CD51) Rabbit mAb (AAA28480) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

product-image-AAA28480_IHC6.jpg IHC (Immunohistchemistry) (Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using Integrin alpha V (ITGAV/CD51) Rabbit mAb (AAA28480) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Mouse liver tissue using Integrin alpha V (ITGAV/CD51) Rabbit mAb (AAA28480) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

product-image-AAA28480_IHC5.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Mouse liver tissue using Integrin alpha V (ITGAV/CD51) Rabbit mAb (AAA28480) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer tissue using Integrin alpha V (ITGAV/CD51) Rabbit mAb (AAA28480) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

product-image-AAA28480_IHC4.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer tissue using Integrin alpha V (ITGAV/CD51) Rabbit mAb (AAA28480) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human placenta tissue using Integrin alpha V (ITGAV/CD51) Rabbit mAb (AAA28480) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

product-image-AAA28480_IHC3.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Human placenta tissue using Integrin alpha V (ITGAV/CD51) Rabbit mAb (AAA28480) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human spleen tissue using Integrin alpha V (ITGAV/CD51) Rabbit mAb (AAA28480) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

product-image-AAA28480_IHC2.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Human spleen tissue using Integrin alpha V (ITGAV/CD51) Rabbit mAb (AAA28480) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

WB (Western Blot)

(Western blot analysis of various lysates using Integrin alpha V (ITGAV/CD51) Rabbit mAb (AAA28480) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)

product-image-AAA28480_WB.jpg WB (Western Blot) (Western blot analysis of various lysates using Integrin alpha V (ITGAV/CD51) Rabbit mAb (AAA28480) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)
Related Product Information for anti-ITGAV antibody
The product of this gene belongs to the integrin alpha chain family. Integrins are heterodimeric integral membrane proteins composed of an alpha subunit and a beta subunit that function in cell surface adhesion and signaling. The encoded preproprotein is proteolytically processed to generate light and heavy chains that comprise the alpha V subunit. This subunit associates with beta 1, beta 3, beta 5, beta 6 and beta 8 subunits. The heterodimer consisting of alpha V and beta 3 subunits is also known as the vitronectin receptor. This integrin may regulate angiogenesis and cancer progression. Alternative splicing results in multiple transcript variants. Note that the integrin alpha 5 and integrin alpha V subunits are encoded by distinct genes.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated MW: 116kDa
Observed MW: 140kDa
UniProt Protein Name
Integrin alpha-V
UniProt Gene Name
ITGAV
UniProt Synonym Gene Names
MSK8; VNRA
UniProt Entry Name
ITAV_HUMAN

Similar Products

Product Notes

The ITGAV itgav (Catalog #AAA28480) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Integrin alpha V (ITGAV/CD51) Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Integrin alpha V (ITGAV/CD51) can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry), FCM/FACS (Flow Cytometry), ELISA. WB: 1:1000-1:6000 IHC-P: 1:1000-1:4000 FC (intra): 1:50-1:200 ELISA: Recommended starting concentration is 1ug/mL. Please optimize the concentration based on your specific assay requirements. Researchers should empirically determine the suitability of the ITGAV itgav for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SLKSSASFNV IEFPYKNLPI EDITNSTLVT TNVTWGIQPA PMPVPVWVII LAVLAGLLLL AVLVFVMYRM GFFKRVRPPQ EEQEREQLQP HENGEGNSET. It is sometimes possible for the material contained within the vial of "Integrin alpha V (ITGAV/CD51), Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.