<
FCM/FACS (Flow Cytometry)
(Flow cytometry:1X10^6 U-937 cells (negative control,left) and HEL cells (right) were intracellularly-stained with Integrin beta 3 (ITGB3/CD61) Rabbit mAb(AAA282669, 2.5 ug/mL,orange line) or Rabbit IgG isotype control (AC042, 2.5 ug/mL,blue line),followed by FITC conjugated goat anti-rabbit pAb(1:200 dilution) staining. Non-fluorescently stained cells were used as blank control (red line).)
Rabbit anti-Human Integrin beta 3 (ITGB3/CD61) Monoclonal Antibody | anti-ITGB3 antibody
Integrin beta 3 (ITGB3/CD61) Rabbit mAb
Reactivity
Human
Applications
ELISA, Flow Cytometry, Functional Assay, Immunoprecipitation, Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
Integrin beta 3 (ITGB3/CD61), Antibody; Integrin beta 3 (ITGB3/CD61) Rabbit mAb; GT; GT2; CD61; GP3A; BDPLT2; GPIIIa; BDPLT16; BDPLT24; Integrin beta 3 (ITGB3/CD61); anti-ITGB3 antibody
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
CVVRFQYYEDSSGKSILYVVEEPECPKGPDILVVLLSVMGAILLIGLAALLIWKLLITIHDRKEFAKFEEERARAKWDTANNPLYKEATSTFTNITYRGT
Applicable Applications for anti-ITGB3 antibody
ELISA, FCM/FACS (Flow Cytometry), IP (Immunoprecipitation), IHC (Immunohistochemistry), WB (Western Blot)
Cross Reactivity
Human, Mouse, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 689-788 of human Integrin beta 3 (ITGB3/CD61)(P05106).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
FCM/FACS (Flow Cytometry)
(Flow cytometry:1X10^6 U-937 cells (negative control,left) and HEL cells (right) were intracellularly-stained with Integrin beta 3 (ITGB3/CD61) Rabbit mAb(AAA282669, 2.5 ug/mL,orange line) or Rabbit IgG isotype control (AC042, 2.5 ug/mL,blue line),followed by FITC conjugated goat anti-rabbit pAb(1:200 dilution) staining. Non-fluorescently stained cells were used as blank control (red line).)
FCM/FACS (Flow Cytometry)
(Flow cytometry:1X10^6 U-937 cells (negative control,left) and HEL cells (right) were intracellularly-stained with Integrin beta 3 (ITGB3/CD61) Rabbit mAb(AAA282669, 2.5 ug/mL,orange line) or Rabbit IgG isotype control (AC042, 2.5 ug/mL,blue line),followed by FITC conjugated goat anti-rabbit pAb(1:200 dilution) staining. Non-fluorescently stained cells were used as blank control (red line).)
IP (Immunoprecipitation)
(Immunoprecipitation analysis of 300 ug extracts of U-87MG cells using 3 ug Integrin beta 3 (ITGB3/CD61) antibody (AAA282669). Western blot was performed from the immunoprecipitate using Integrin beta 3 (ITGB3/CD61) antibody (AAA282669) at a dilution of 1:1000.)
IP (Immunoprecipitation)
(Immunoprecipitation analysis of 300 ug extracts of U-87MG cells using 3 ug Integrin beta 3 (ITGB3/CD61) antibody (AAA282669). Western blot was performed from the immunoprecipitate using Integrin beta 3 (ITGB3/CD61) antibody (AAA282669) at a dilution of 1:1000.)
IHC (Immunohistochemisry)
(Immunohistochemistry analysis of paraffin-embedded Mouse bone marrow using Integrin beta 3 (ITGB3/CD61) Rabbit mAb (AAA282669) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.)
IHC (Immunohistochemisry)
(Immunohistochemistry analysis of paraffin-embedded Mouse bone marrow using Integrin beta 3 (ITGB3/CD61) Rabbit mAb (AAA282669) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.)
IHC (Immunohiostchemistry)
(Immunohistochemistry analysis of paraffin-embedded Rat bone marrow using Integrin beta 3 (ITGB3/CD61) Rabbit mAb (AAA282669) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.)
IHC (Immunohiostchemistry)
(Immunohistochemistry analysis of paraffin-embedded Rat bone marrow using Integrin beta 3 (ITGB3/CD61) Rabbit mAb (AAA282669) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.)
WB (Western Blot)
(Western blot analysis of various lysates using Integrin beta 3 (ITGB3/CD61) Rabbit mAb (AAA282669) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)
WB (Western Blot)
(Western blot analysis of various lysates using Integrin beta 3 (ITGB3/CD61) Rabbit mAb (AAA282669) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)
Related Product Information for anti-ITGB3 antibody
The ITGB3 protein product is the integrin beta chain beta 3. Integrins are integral cell-surface proteins composed of an alpha chain and a beta chain. A given chain may combine with multiple partners resulting in different integrins. Integrin beta 3 is found along with the alpha IIb chain in platelets. Integrins are known to participate in cell adhesion as well as cell-surface mediated signalling.
Product Categories/Family for anti-ITGB3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated MW: 87kDa
Observed MW: 110kDa
Observed MW: 110kDa
UniProt Protein Name
Integrin beta-3
UniProt Gene Name
ITGB3
UniProt Synonym Gene Names
GP3A; GPIIIa
UniProt Entry Name
ITB3_HUMAN
Similar Products
Product Notes
The ITGB3 itgb3 (Catalog #AAA282669) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Integrin beta 3 (ITGB3/CD61) Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Integrin beta 3 (ITGB3/CD61) can be used in a range of immunoassay formats including, but not limited to, ELISA, FCM/FACS (Flow Cytometry), IP (Immunoprecipitation), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the ITGB3 itgb3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: CVVRFQYYED SSGKSILYVV EEPECPKGPD ILVVLLSVMG AILLIGLAAL LIWKLLITIH DRKEFAKFEE ERARAKWDTA NNPLYKEATS TFTNITYRGT. It is sometimes possible for the material contained within the vial of "Integrin beta 3 (ITGB3/CD61), Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.