Rabbit anti-Human JAB1/CSN5/COPS5 Monoclonal Antibody | anti-COPS5 antibody

JAB1/CSN5/COPS5 Rabbit mAb

Cat. Num. AAA28603

• Reactivity: Human
• Applications: Western Blot, Immunohistochemistry, Immunofluorescence, Immunocytochemistry, ELISA, Chromatin Immunoprecipitation, Immunoprecipitation
• Purity: Affinity purification
• Synonyms: JAB1/CSN5/COPS5, Antibody; JAB1/CSN5/COPS5 Rabbit mAb; CSN5; JAB1; SGN5; MOV-34; JAB1/CSN5/COPS5; anti-COPS5 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG
• Purity/Purification: Affinity purification
• Form/Format: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
• Sequence: MAASGSGMAQKTWELANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHYFKYCKISALALLKMVMHARSGGNLEVMGLMLGKVDGETMIIMDSFALPV

• Applicable Applications for anti-COPS5 antibody: Western Blot (WB), Immunohistochemistry-Paraffin (IHC-P), Immunofluorescence (IF), Immunocytochemistry (ICC), ELISA (EIA), Chromatin Immunoprecipitation (ChIP)
• Application Notes: WB: 1:500-1:2000; IHC-P: 1:50-1:200; IF/ICC: 1:50-1:200; ELISA: Recommended starting concentration is 1ug/mL.; Please optimize the concentration based on your specific assay requirements.; ChIP: 5ug antibody for 10ug-15ug of Chromatin
• Cross Reactivity: Human, Mouse, Rat
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human JAB1/CSN5/COPS5 (Q92905).
• Preparation and Storage: Store at -20 degree C. Avoid freeze/thaw cycles.

ChIP (Chromatin Immunoprecipitation)

(Chromatin immunoprecipitation analysis of extracts of HeLa cells, using JAB1/CSN5/COPS5 antibody (AAA28603) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.)

IF (Immunofluorescence)

(Immunofluorescence analysis of U-2 OS cells using JAB1/CSN5/COPS5 Rabbit mAb (AAA28603) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of NIH-3T3 cells using JAB1/CSN5/COPS5 Rabbit mAb (AAA28603) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Mouse colon tissue using JAB1/CSN5/COPS5 Rabbit mAb (AAA28603) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

IHC (Immunohistchemistry)

(Immunohistochemistry analysis of paraffin-embedded Rat testis tissue using JAB1/CSN5/COPS5 Rabbit mAb (AAA28603) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using JAB1/CSN5/COPS5 Rabbit mAb (AAA28603) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using JAB1/CSN5/COPS5 Rabbit mAb (AAA28603) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human breast tissue using JAB1/CSN5/COPS5 Rabbit mAb (AAA28603) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human liver cancer tissue using JAB1/CSN5/COPS5 Rabbit mAb (AAA28603) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

WB (Western Blot)

(Western blot analysis of various lysates using JAB1/CSN5/COPS5 Rabbit mAb (AAA28603) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

Related Product Information for anti-COPS5 antibody

The protein encoded by this gene is one of the eight subunits of COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases. This protein is reported to be involved in the degradation of cyclin-dependent kinase inhibitor CDKN1B/p27Kip1. It is also known to be an coactivator that increases the specificity of JUN/AP1 transcription factors.

Product Categories/Family for anti-COPS5 antibody

Epigenetics Nuclear Signaling; Cancer; Tumor suppressors; p53 pathway; Cell Biology Developmental Biology; Cell Cycle; Cell cycle inhibitors; Ubiquitin; Antibodies

NCBI and Uniprot Product Information

• NCBI GI #: 38027923
• NCBI GeneID: 10987
• NCBI Accession #: NP_006828.2
• NCBI GenBank Nucleotide #: NM_006837.2
• UniProt Accession #: Q92905; O15386; Q6AW95; Q86WQ4; Q9BQ17
• Molecular Weight: Calculated MW: 38kDa; Observed MW: 35kDa
• UniProt Protein Name: COP9 signalosome complex subunit 5
• UniProt Gene Name: COPS5
• UniProt Synonym Gene Names: CSN5; JAB1; SGN5
• UniProt Entry Name: CSN5_HUMAN