Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197474_WB13.jpg WB (Western Blot) (WB Suggested Anti-COPS5 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)

Rabbit anti-Human COPS5 Polyclonal Antibody | anti-COPS5 antibody

COPS5 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
COPS5; CSN5; JAB1; SGN5; MOV-34
Reactivity
Human
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
COPS5, Antibody; COPS5 antibody - N-terminal region; anti-COPS5 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHYFKYCKISALALLKMVM
Sequence Length
334
Applicable Applications for anti-COPS5 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human COPS5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-COPS5 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)

product-image-AAA197474_WB13.jpg WB (Western Blot) (WB Suggested Anti-COPS5 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)

IHC (Immunohistochemistry)

(Human Heart)

product-image-AAA197474_IHC15.jpg IHC (Immunohistochemistry) (Human Heart)
Related Product Information for anti-COPS5 antibody
This is a rabbit polyclonal antibody against COPS5. It was validated on Western Blot and immunohistochemistry

Target Description: The protein encoded by COPS5 is one of the eight subunits of COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases. This protein is reported to be involved in the degradation of cyclin-dependent kinase inhibitor CDKN1B/p27Kip1. It is also known to be an coactivator that increases the specificity of JUN/AP1 transcription factors.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Full Name
COP9 signalosome complex subunit 5
NCBI Official Synonym Full Names
COP9 signalosome subunit 5
NCBI Official Symbol
COPS5
NCBI Official Synonym Symbols
CSN5; JAB1; SGN5; MOV-34
NCBI Protein Information
COP9 signalosome complex subunit 5
UniProt Protein Name
COP9 signalosome complex subunit 5
UniProt Gene Name
COPS5
UniProt Synonym Gene Names
CSN5; JAB1; SGN5
UniProt Entry Name
CSN5_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The COPS5 cops5 (Catalog #AAA197474) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The COPS5 antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's COPS5 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the COPS5 cops5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NMQEAQSIDE IYKYDKKQQQ EILAAKPWTK DHHYFKYCKI SALALLKMVM. It is sometimes possible for the material contained within the vial of "COPS5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.