Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA28603_ChIP10.jpg ChIP (Chromatin Immunoprecipitation) (Chromatin immunoprecipitation analysis of extracts of HeLa cells, using JAB1/CSN5/COPS5 antibody (AAA28603) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.)

Rabbit anti-Human JAB1/CSN5/COPS5 Monoclonal Antibody | anti-COPS5 antibody

JAB1/CSN5/COPS5 Rabbit mAb

Reactivity
Human
Applications
Western Blot, Immunohistochemistry, Immunofluorescence, Immunocytochemistry, ELISA, Chromatin Immunoprecipitation, Immunoprecipitation
Purity
Affinity purification
Synonyms
JAB1/CSN5/COPS5, Antibody; JAB1/CSN5/COPS5 Rabbit mAb; CSN5; JAB1; SGN5; MOV-34; JAB1/CSN5/COPS5; anti-COPS5 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
MAASGSGMAQKTWELANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHYFKYCKISALALLKMVMHARSGGNLEVMGLMLGKVDGETMIIMDSFALPV
Applicable Applications for anti-COPS5 antibody
WB (Western Blot), IHC (Immunohistochemistry), IF (Immunofluorescence), ICC (Immunocytochemistry), ELISA, ChIP (Chromatin Immunoprecipitation)
Application Notes
WB: 1:500-1:2000
IHC-P: 1:50-1:200
IF/ICC: 1:50-1:200
ELISA: Recommended starting concentration is 1ug/mL.
Please optimize the concentration based on your specific assay requirements.
ChIP: 5ug antibody for 10ug-15ug of Chromatin
Cross Reactivity
Human, Mouse, Rat
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human JAB1/CSN5/COPS5 (Q92905).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

ChIP (Chromatin Immunoprecipitation)

(Chromatin immunoprecipitation analysis of extracts of HeLa cells, using JAB1/CSN5/COPS5 antibody (AAA28603) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.)

product-image-AAA28603_ChIP10.jpg ChIP (Chromatin Immunoprecipitation) (Chromatin immunoprecipitation analysis of extracts of HeLa cells, using JAB1/CSN5/COPS5 antibody (AAA28603) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.)

IF (Immunofluorescence)

(Immunofluorescence analysis of U-2 OS cells using JAB1/CSN5/COPS5 Rabbit mAb (AAA28603) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

product-image-AAA28603_IF9.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U-2 OS cells using JAB1/CSN5/COPS5 Rabbit mAb (AAA28603) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of NIH-3T3 cells using JAB1/CSN5/COPS5 Rabbit mAb (AAA28603) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

product-image-AAA28603_IF8.jpg IF (Immunofluorescence) (Immunofluorescence analysis of NIH-3T3 cells using JAB1/CSN5/COPS5 Rabbit mAb (AAA28603) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Mouse colon tissue using JAB1/CSN5/COPS5 Rabbit mAb (AAA28603) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

product-image-AAA28603_IHC7.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Mouse colon tissue using JAB1/CSN5/COPS5 Rabbit mAb (AAA28603) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

IHC (Immunohistchemistry)

(Immunohistochemistry analysis of paraffin-embedded Rat testis tissue using JAB1/CSN5/COPS5 Rabbit mAb (AAA28603) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

product-image-AAA28603_IHC6.jpg IHC (Immunohistchemistry) (Immunohistochemistry analysis of paraffin-embedded Rat testis tissue using JAB1/CSN5/COPS5 Rabbit mAb (AAA28603) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using JAB1/CSN5/COPS5 Rabbit mAb (AAA28603) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

product-image-AAA28603_IHC5.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using JAB1/CSN5/COPS5 Rabbit mAb (AAA28603) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using JAB1/CSN5/COPS5 Rabbit mAb (AAA28603) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

product-image-AAA28603_IHC4.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using JAB1/CSN5/COPS5 Rabbit mAb (AAA28603) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human breast tissue using JAB1/CSN5/COPS5 Rabbit mAb (AAA28603) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

product-image-AAA28603_IHC3.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Human breast tissue using JAB1/CSN5/COPS5 Rabbit mAb (AAA28603) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human liver cancer tissue using JAB1/CSN5/COPS5 Rabbit mAb (AAA28603) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

product-image-AAA28603_IHC2.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Human liver cancer tissue using JAB1/CSN5/COPS5 Rabbit mAb (AAA28603) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

WB (Western Blot)

(Western blot analysis of various lysates using JAB1/CSN5/COPS5 Rabbit mAb (AAA28603) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

product-image-AAA28603_WB.jpg WB (Western Blot) (Western blot analysis of various lysates using JAB1/CSN5/COPS5 Rabbit mAb (AAA28603) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)
Related Product Information for anti-COPS5 antibody
The protein encoded by this gene is one of the eight subunits of COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases. This protein is reported to be involved in the degradation of cyclin-dependent kinase inhibitor CDKN1B/p27Kip1. It is also known to be an coactivator that increases the specificity of JUN/AP1 transcription factors.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated MW: 38kDa
Observed MW: 35kDa
UniProt Protein Name
COP9 signalosome complex subunit 5
UniProt Gene Name
COPS5
UniProt Synonym Gene Names
CSN5; JAB1; SGN5
UniProt Entry Name
CSN5_HUMAN

Similar Products

Product Notes

The COPS5 cops5 (Catalog #AAA28603) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The JAB1/CSN5/COPS5 Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's JAB1/CSN5/COPS5 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry), IF (Immunofluorescence), ICC (Immunocytochemistry), ELISA, ChIP (Chromatin Immunoprecipitation). WB: 1:500-1:2000 IHC-P: 1:50-1:200 IF/ICC: 1:50-1:200 ELISA: Recommended starting concentration is 1ug/mL. Please optimize the concentration based on your specific assay requirements. ChIP: 5ug antibody for 10ug-15ug of Chromatin. Researchers should empirically determine the suitability of the COPS5 cops5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAASGSGMAQ KTWELANNMQ EAQSIDEIYK YDKKQQQEIL AAKPWTKDHH YFKYCKISAL ALLKMVMHAR SGGNLEVMGL MLGKVDGETM IIMDSFALPV. It is sometimes possible for the material contained within the vial of "JAB1/CSN5/COPS5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.