Mouse MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1) Monoclonal Antibody | anti-MAP3K1 antibody

MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1) Mouse Monoclonal Antibody

Cat. Num. AAA62861

• Gene Names: MAP3K1; MEKK; MEKK1; SRXY6; MEKK 1; MAPKKK1
• Reactivity: Human. Others not known
• Applications: Immunohistochemistry, Western Blot, Immunofluorescence, Flow Cytometry, Functional Assay
• Synonyms: MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1), Antibody; MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1) Mouse Monoclonal Antibody; MEKK1; MEK Kinase 1; MEKK; SRXY6; MAPKKK1; anti-MAP3K1 antibody

• Host: Mouse
• Reactivity: Human. Others not known
• Clonality: Monoclonal
• Isotype: IgG2a, kappa
• Clone Number: 2F6
• Specificity: Mitogen-activated protein (MAP) kinase cascades are activated by various extracellular stimuli, including growth factors. The MEK kinases (also designated MAP kinase kinase kinases, MKKKs, MAP3Ks or MEKKs) phosphorylate and thereby activate the MEKs (also called MAP kinase kinases or MKKs), including ERK, JNK and p38. These activated MEKs in turn phosphorylate and activate the MAP kinases. The MEK kinases include Raf-1, Raf-B, Mos, MEK kinase-1, MEK kinase-2, MEK kinase-3, MEK kinase-4 and ASK 1 (MEK kinase- 5). MEK kinase-1 activates the ERK and c-Jun NH2-terminal kinase (JNK) pathways by phosphorylation of MAP2K1 and MAP2K4, and also activates the central protein kinases of the NF-kB pathway, CHUK and IKBKB. Additionally, MEK kinase-1 uses an E3 ligase through its PHD domain, a RING-finger-like structure, to target proteins for degradation through ubiquitination.
• Form/Format: 200ug/ml of Ab purified from Bioreactor Concentrate by Protein A/G. Prepared in 10mM PBS with 0.05% BSA & 0.05% azide. Also available WITHOUT BSA & azide at 1.0mg/ml.
• Sequence Length: 1512

• Applicable Applications for anti-MAP3K1 antibody: IHC (Immunohistochemistry), WB (Western Blot), IF (Immunofluorescence), FCM/FACS (Flow Cytometry)
• Cellular Localization: Cytoplasmic
• Immunogen: Partial recombinant MAP3K1 (aa1211-1310) (SKNSMTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTP-VEEKCRLDVNTELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQK)
• Hu-Chromosome Location: 5q11.2
• Positive Control: A431, HeLa or HL-60 cells or liver tissue.
• Preparation and Storage: Antibody with azide - store at 2 to 8 degree C. Antibody without azide - store at -20 to -80 degree C. Antibody is stable for 24 months. Non-hazardous. No MSDS required.

IHC (Immunohistochemisry)

(Formalin-fixed, paraffin-embedded human Cervical Carcinoma stained with MAP3K1 Monoclonal Antibody (2F6).)

IHC (Immunohiostchemistry)

(Formalin-fixed, paraffin-embedded human Thyroid Carcinoma stained with MAP3K1 Monoclonal Antibody (2F6).)

IHC (Immunohistochemistry)

(Formalin-fixed, paraffin-embedded human Uterine Carcinoma stained with MAP3K1 Monoclonal Antibody (2F6).)

References

Guan, K.L. 1994. The mitogen activated protein kinase signal transduction pathway: from the cell surface to the nucleus. Cell. Signal. 6: 581-589

NCBI and Uniprot Product Information

• NCBI GI #: 153945765
• NCBI GeneID: 4214
• NCBI Accession #: NP_005912.1
• NCBI GenBank Nucleotide #: NM_005921.1
• UniProt Accession #: Q13233
• Molecular Weight: 195kDa (intact); 80kDa (cleaved)
• NCBI Official Full Name: mitogen-activated protein kinase kinase kinase 1
• NCBI Official Synonym Full Names: mitogen-activated protein kinase kinase kinase 1
• NCBI Official Symbol: MAP3K1
• NCBI Official Synonym Symbols: MEKK; MEKK1; SRXY6; MEKK 1; MAPKKK1
• NCBI Protein Information: mitogen-activated protein kinase kinase kinase 1
• UniProt Protein Name: Mitogen-activated protein kinase kinase kinase 1
• UniProt Gene Name: MAP3K1
• UniProt Synonym Gene Names: MAPKKK1; MEKK; MEKK1; MEK kinase 1; MEKK 1
• UniProt Entry Name: M3K1_HUMAN