Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199942_WB11.jpg WB (Western Blot) (WB Suggested Anti-MAP3K1 Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysate)

Rabbit MAP3K1 Polyclonal Antibody | anti-MAP3K1 antibody

MAP3K1 antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
MAP3K1; MEKK; MEKK1; SRXY6; MEKK 1; MAPKKK1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MAP3K1, Antibody; MAP3K1 antibody - C-terminal region; anti-MAP3K1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LGAFSSCYQAQDVGTGTLMAVKQVTYVRNTSSEQEEVVEALREEIRMMSH
Sequence Length
1512
Applicable Applications for anti-MAP3K1 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human MAP3K1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-MAP3K1 Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysate)

product-image-AAA199942_WB11.jpg WB (Western Blot) (WB Suggested Anti-MAP3K1 Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: MAP3K1Sample Tissue: Human Jurkat Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA199942_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: MAP3K1Sample Tissue: Human Jurkat Whole CellAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: MAP3K1Sample Tissue: Human Jurkat Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA199942_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: MAP3K1Sample Tissue: Human Jurkat Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-MAP3K1 antibody
This is a rabbit polyclonal antibody against MAP3K1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: MAP3K, or MEK kinase, is a serine/threonine kinase that occupies a pivotal role in a network of phosphorylating enzymes integrating cellular responses to a number of mitogenic and metabolic stimuli, including insulin (MIM 176730) and many growth factors.MAP3K, or MEK kinase, is a serine/threonine kinase that occupies a pivotal role in a network of phosphorylating enzymes integrating cellular responses to a number of mitogenic and metabolic stimuli, including insulin (MIM 176730) and many growth factors.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-983 AC008937.7 118022-119004 c 984-1536 AF042838.1 426-978 1537-1653 AC008937.7 68621-68737 c 1654-1802 AC008937.7 68100-68248 c 1803-2870 AF042838.1 1245-2312 2871-4167 AC008937.7 51211-52507 c 4168-4758 BU194120.1 127-717 4759-5154 DA889202.1 164-559 5155-7355 AC008937.7 38082-40282 c 7356-7522 AA602425.1 1-167 c

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
164kDa
NCBI Official Full Name
mitogen-activated protein kinase kinase kinase 1
NCBI Official Synonym Full Names
mitogen-activated protein kinase kinase kinase 1
NCBI Official Symbol
MAP3K1
NCBI Official Synonym Symbols
MEKK; MEKK1; SRXY6; MEKK 1; MAPKKK1
NCBI Protein Information
mitogen-activated protein kinase kinase kinase 1
UniProt Protein Name
Mitogen-activated protein kinase kinase kinase 1
UniProt Gene Name
MAP3K1
UniProt Synonym Gene Names
MAPKKK1; MEKK; MEKK1; MEK kinase 1; MEKK 1
UniProt Entry Name
M3K1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The MAP3K1 map3k1 (Catalog #AAA199942) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MAP3K1 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's MAP3K1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the MAP3K1 map3k1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LGAFSSCYQA QDVGTGTLMA VKQVTYVRNT SSEQEEVVEA LREEIRMMSH. It is sometimes possible for the material contained within the vial of "MAP3K1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.