Mouse anti-Human MCM2 Monoclonal Antibody | anti-MCM2 antibody

MCM2 (DNA Replication Licensing Factor MCM2, Minichromosome Maintenance Protein 2 Homolog, Nuclear Protein BM28, BM28, CCNL1, CDCL1, KIAA0030, MGC10606) (PE)

Cat. Num. AAA25745

• Gene Names: MCM2; BM28; CCNL1; CDCL1; cdc19; DFNA70; D3S3194; MITOTIN
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: MCM2, Antibody; MCM2 (DNA Replication Licensing Factor MCM2, Minichromosome Maintenance Protein 2 Homolog, Nuclear Protein BM28, BM28, CCNL1, CDCL1, KIAA0030, MGC10606) (PE); anti-MCM2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 6A8
• Specificity: Recognizes human MCM2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-MCM2 antibody: ELISA (EIA), Immunofluorescence (IF), Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa805-904 from human MCM2 (AAH07670) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: TQKFSVMRSMRKTFARYLSFRRDNNELLLFILKQLVAEQVTYQRNRFGAQQDTIEVPEKDLVDKARQINIHNLSAFYDSELFRMNKFSHDLKRKMILQQF
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

WB (Western Blot)

(Western Blot detection against Immunogen (36.63kD).)

Application Data

(Detection limit for recombinant GST tagged MCM2 is ~0.1ng/ml as a capture antibody.)

IP (Immunoprecipitation)

(Immunoprecipitation of MCM2 transfected lysate using MCM2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with MCM2 rabbit polyclonal antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to MCM2 on HeLa cell. [antibody concentration 10ug/ml])

WB (Western Blot)

(Western Blot analysis of MCM2 expression in transfected 293T cell line by MCM2 monoclonal antibody. Lane 1: MCM2 transfected lysate (101.9kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(MCM2 monoclonal antibody Western Blot analysis of MCM2 expression in HeLa NE.)

Product Categories/Family for anti-MCM2 antibody

Antibodies; DNA Replication; Repair

NCBI and Uniprot Product Information

• NCBI GI #: 37589852
• NCBI GeneID: 4171
• Molecular Weight: 101,896 Da
• NCBI Official Full Name: Homo sapiens minichromosome maintenance complex component 2, mRNA
• NCBI Official Synonym Full Names: minichromosome maintenance complex component 2
• NCBI Official Symbol: MCM2
• NCBI Official Synonym Symbols: BM28; CCNL1; CDCL1; cdc19; DFNA70; D3S3194; MITOTIN
• NCBI Protein Information: DNA replication licensing factor MCM2