Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282315_IF11.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U2OS cells using NF-kB p65/RelA Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

Rabbit NF-kB p65/RelA Monoclonal Antibody | anti-NF-kBp65/RelA antibody

NF-kB p65/RelA Rabbit pAb

Gene Names
BDNF; ANON2; BULN2
Reactivity
Human, Mouse, Rat
Applications
Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
NF-kB p65/RelA, Antibody; NF-kB p65/RelA Rabbit pAb; RELA; NFKB3; p65; transcription factor p65; anti-NF-kBp65/RelA antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
lgG2a, kappa
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300,50% glycerol,pH7.3.
Sequence
PMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR
Applicable Applications for anti-NF-kBp65/RelA antibody
ICC (Immunocytochemistry), IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 100-200 of human NF-kB p65/RelA (NP_068810.3).
Cellular Location
Cytoplasm, Nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of U2OS cells using NF-kB p65/RelA Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA282315_IF11.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U2OS cells using NF-kB p65/RelA Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of PC-12 cells using NF-kB p65/RelA Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA282315_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of PC-12 cells using NF-kB p65/RelA Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of NIH/3T3 cells using NF-kB p65/RelA Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA282315_IF15.jpg IF (Immunofluorescence) (Immunofluorescence analysis of NIH/3T3 cells using NF-kB p65/RelA Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)
Related Product Information for anti-NF-kBp65/RelA antibody
NF-kappa-B is a ubiquitous transcription factor involved in several biological processes. It is held in the cytoplasm in an inactive state by specific inhibitors. Upon degradation of the inhibitor, NF-kappa-B moves to the nucleus and activates transcription of specific genes. NF-kappa-B is composed of NFKB1 or NFKB2 bound to either REL, RELA, or RELB. The most abundant form of NF-kappa-B is NFKB1 complexed with the product of this gene, RELA. Four transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
627
UniProt Accession #
Molecular Weight
247
NCBI Official Full Name
Brain-derived neurotrophic factor
NCBI Official Synonym Full Names
brain-derived neurotrophic factor
NCBI Official Symbol
BDNF
NCBI Official Synonym Symbols
ANON2; BULN2
NCBI Protein Information
brain-derived neurotrophic factor; abrineurin; neurotrophin
UniProt Protein Name
Brain-derived neurotrophic factor
UniProt Gene Name
BDNF
UniProt Synonym Gene Names
BDNF
UniProt Entry Name
BDNF_HUMAN

Similar Products

Product Notes

The NF-kBp65/RelA bdnf (Catalog #AAA282315) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NF-kB p65/RelA Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NF-kB p65/RelA can be used in a range of immunoassay formats including, but not limited to, ICC (Immunocytochemistry), IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the NF-kBp65/RelA bdnf for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: PMKEANIRGQ GGLAYPGVRT HGTLESVNGP KAGSRGLTSL ADTFEHVIEE LLDEDQKVRP NEENNKDADL YTSRVMLSSQ VPLEPPLLFL LEEYKNYLDA ANMSMRVRRH SDPARRGELS VCDSISEWVT AADKKTAVDM SGGTVTVLEK VPVSKGQLKQ YFYETKCNPM GYTKEGCRGI DKRHWNSQCR TTQSYVRALT MDSKKRIGWR FIRIDTSCVC TLTIKRGR. It is sometimes possible for the material contained within the vial of "NF-kB p65/RelA, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.