Rabbit anti-Human ORP150/GRP170/HSP12A Monoclonal Antibody | anti-HYOU1 antibody

ORP150/GRP170/HSP12A Rabbit mAb

Cat. Num. AAA282620

• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Affinity purification
• Synonyms: ORP150/GRP170/HSP12A, Antibody; ORP150/GRP170/HSP12A Rabbit mAb; IMD59; Grp170; HSP12A; ORP150; GRP-170; ORP-150; ORP150/GRP170/HSP12A; anti-HYOU1 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG
• Purity/Purification: Affinity purification
• Form/Format: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
• Sequence: MADKVRRQRPRRRVCWALVAVLLADLLALSDTLAVMSVDLGSESMKVAIVKPGVPMEIVLNKESRRKTPVIVTLKENERFFGDSAASMAIKNPKATLRYFQHLLGKQADNPHVALYQARFPEHELTFDPQRQTVHFQISSQLQFSPEEVL

• Applicable Applications for anti-HYOU1 antibody: ELISA, IHC (Immunohistochemistry), WB (Western Blot)
• Cross Reactivity: Human, Mouse, Rat
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human ORP150/GRP170/HSP12A (Q9Y4L1).
• Preparation and Storage: Store at -20 degree C. Avoid freeze/thaw cycles.

IHC (Immunohiostchemistry)

(Immunohistochemistry analysis of paraffin-embedded Rat pancreas using ORP150/GRP170/HSP12A Rabbit mAb (AAA282620) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.)

WB (Western Blot)

(Western blot analysis of various lysates using ORP150/GRP170/HSP12A Rabbit mAb (AAA282620) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)

Related Product Information for anti-HYOU1 antibody

The protein encoded by this gene belongs to the heat shock protein 70 family. This gene uses alternative transcription start sites. A cis-acting segment found in the 5' UTR is involved in stress-dependent induction, resulting in the accumulation of this protein in the endoplasmic reticulum (ER) under hypoxic conditions. The protein encoded by this gene is thought to play an important role in protein folding and secretion in the ER. Since suppression of the protein is associated with accelerated apoptosis, it is also suggested to have an important cytoprotective role in hypoxia-induced cellular perturbation. This protein has been shown to be up-regulated in tumors, especially in breast tumors, and thus it is associated with tumor invasiveness. This gene also has an alternative translation initiation site, resulting in a protein that lacks the N-terminal signal peptide. This signal peptide-lacking protein, which is only 3 amino acids shorter than the mature protein in the ER, is thought to have a housekeeping function in the cytosol. In rat, this protein localizes to both the ER by a carboxy-terminal peptide sequence and to mitochondria by an amino-terminal targeting signal. Alternative splicing results in multiple transcript variants.

Product Categories/Family for anti-HYOU1 antibody

Epigenetics Nuclear Signaling; Cancer; Invasion and Metastasis; Signal Transduction; Endocrine Metabolism; Neuroscience; Neurodegenerative Diseases; Cardiovascular; Hypoxia; Antibodies

NCBI and Uniprot Product Information

• NCBI GI #: 47938913
• NCBI GeneID: 10525
• UniProt Accession #: Q9Y4L1; Q2I204; Q53H25; A8C1Z0
• Molecular Weight: Calculated MW: 111kDa; Observed MW: 150kDa
• UniProt Protein Name: Hypoxia up-regulated protein 1
• UniProt Gene Name: HYOU1
• UniProt Synonym Gene Names: GRP170; ORP150; ORP-150; GRP-170
• UniProt Entry Name: HYOU1_HUMAN