<
ChIP (Chromatin Immunoprecipitation)
(Chromatin immunoprecipitation analysis of extracts of A-549 cells, using Rad21 antibody (AAA282810) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.)
Rabbit anti-Human Rad21 Monoclonal Antibody | anti-RAD21 antibody
Rad21 Rabbit mAb
Reactivity
Human
Applications
Chromatin Immunoprecipitation, Immunoprecipitation, Chromatin Immunoprecipitation, Immunoprecipitation, ELISA, Western Blot
Purity
Affinity purification
Synonyms
Rad21, Antibody; Rad21 Rabbit mAb; MGS; HR21; MCD1; NXP1; SCC1; CDLS4; hHR21; HRAD21; Rad21; anti-RAD21 antibody
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
EKEDDEEEEDEDASGGDQDQEERRWNKRTQQMLHGLQRALAKTGAESISLLELCRNTNRKQAAAKFYSFLVLKKQQAIELTQEEPYSDIIATPGPRFHII
Applicable Applications for anti-RAD21 antibody
ChIP (Chromatin immunoprecipitation), ChIP (Chromatin immunoprecipitation), ELISA, WB (Western Blot)
Cross Reactivity
Human, Mouse, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 532-631 of human Rad21 (O60216).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
ChIP (Chromatin Immunoprecipitation)
(Chromatin immunoprecipitation analysis of extracts of A-549 cells, using Rad21 antibody (AAA282810) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.)
ChIP (Chromatin Immunoprecipitation)
(Chromatin immunoprecipitation analysis of extracts of A-549 cells, using Rad21 antibody (AAA282810) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.)
WB (Western Blot)
(Western blot analysis of various lysates using Rad21 Rabbit mAb (AAA282810) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 180s.)
WB (Western Blot)
(Western blot analysis of various lysates using Rad21 Rabbit mAb (AAA282810) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 180s.)
ChIP (Chromatin Immunoprecipitation)
(Chromatin immunoprecipitation was performed with 10.7 ug of cross-linked chromatin from A-549 cells using 5 ug of Rad21 Rabbit mAb (AAA282810). DNA libraries were prepared using Scale ssDNA-seq Lib Prep Kit for Illumina V2 (RK20228). The ChIP sequencing results indicate the enrichment pattern of Rad21 in the representative genomic region surrounding MYC gene.)
ChIP (Chromatin Immunoprecipitation)
(Chromatin immunoprecipitation was performed with 10.7 ug of cross-linked chromatin from A-549 cells using 5 ug of Rad21 Rabbit mAb (AAA282810). DNA libraries were prepared using Scale ssDNA-seq Lib Prep Kit for Illumina V2 (RK20228). The ChIP sequencing results indicate the enrichment pattern of Rad21 in the representative genomic region surrounding MYC gene.)
ChIP (Chromatin Immunoprecipitation)
(Chromatin immunoprecipitation was performed with 10.7 ug of cross-linked chromatin from A-549 cells using 5 ug of Rad21 Rabbit mAb (AAA282810). DNA libraries were prepared using Scale ssDNA-seq Lib Prep Kit for Illumina V2 (RK20228). The ChIP sequencing results indicate the enrichment pattern of Rad21 across chromosome 8 (upper panel) and the genomic region encompassing MYC, a representative gene enriched in Rad21 (lower panel).)
ChIP (Chromatin Immunoprecipitation)
(Chromatin immunoprecipitation was performed with 10.7 ug of cross-linked chromatin from A-549 cells using 5 ug of Rad21 Rabbit mAb (AAA282810). DNA libraries were prepared using Scale ssDNA-seq Lib Prep Kit for Illumina V2 (RK20228). The ChIP sequencing results indicate the enrichment pattern of Rad21 across chromosome 8 (upper panel) and the genomic region encompassing MYC, a representative gene enriched in Rad21 (lower panel).)
Related Product Information for anti-RAD21 antibody
The protein encoded by this gene is highly similar to the gene product of Schizosaccharomyces pombe rad21, a gene involved in the repair of DNA double-strand breaks, as well as in chromatid cohesion during mitosis. This protein is a nuclear phospho-protein, which becomes hyperphosphorylated in cell cycle M phase. The highly regulated association of this protein with mitotic chromatin specifically at the centromere region suggests its role in sister chromatid cohesion in mitotic cells.
Product Categories/Family for anti-RAD21 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated MW: 72kDa
Observed MW: 130kDa
Observed MW: 130kDa
UniProt Protein Name
Double-strand-break repair protein rad21 homolog
UniProt Gene Name
RAD21
UniProt Synonym Gene Names
; hHR21; NXP-1
Similar Products
Product Notes
The RAD21 rad21 (Catalog #AAA282810) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Rad21 Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Rad21 can be used in a range of immunoassay formats including, but not limited to, ChIP (Chromatin immunoprecipitation), ChIP (Chromatin immunoprecipitation), ELISA, WB (Western Blot). Researchers should empirically determine the suitability of the RAD21 rad21 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: EKEDDEEEED EDASGGDQDQ EERRWNKRTQ QMLHGLQRAL AKTGAESISL LELCRNTNRK QAAAKFYSFL VLKKQQAIEL TQEEPYSDII ATPGPRFHII. It is sometimes possible for the material contained within the vial of "Rad21, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.