WB (Western Blot)
(Western blot analysis of various lysates using Reptin/RUVBL2 Rabbit mAb (AAA283095) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)
Rabbit anti-Human Reptin/RUVBL2 Monoclonal Antibody | anti-RUVBL2 antibody
Reptin/RUVBL2 Rabbit mAb
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity purification
Synonyms
Reptin/RUVBL2, Antibody; Reptin/RUVBL2 Rabbit mAb; RVB2; TIH2; ECP51; TIP48; CGI-46; ECP-51; INO80J; REPTIN; TIP49B; TAP54-beta; Reptin/RUVBL2; anti-RUVBL2 antibody
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
LLDRLLIVSTTPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAF
Applicable Applications for anti-RUVBL2 antibody
ELISA, WB (Western Blot)
Cross Reactivity
Human, Mouse, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 350-450 of human Reptin/RUVBL2 (Q9Y230).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
WB (Western Blot)
(Western blot analysis of various lysates using Reptin/RUVBL2 Rabbit mAb (AAA283095) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)
WB (Western Blot)
(Western blot analysis of various lysates using Reptin/RUVBL2 Rabbit mAb (AAA283095) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)
WB (Western Blot)
(Western blot analysis of various lysates using Reptin/RUVBL2 Rabbit mAb (AAA283095) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3s.)
WB (Western Blot)
(Western blot analysis of various lysates using Reptin/RUVBL2 Rabbit mAb (AAA283095) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3s.)
Related Product Information for anti-RUVBL2 antibody
This gene encodes the second human homologue of the bacterial RuvB gene. Bacterial RuvB protein is a DNA helicase essential for homologous recombination and DNA double-strand break repair. Functional analysis showed that this gene product has both ATPase and DNA helicase activities. This gene is physically linked to the CGB/LHB gene cluster on chromosome 19q13.3, and is very close (55 nt) to the LHB gene, in the opposite orientation.
Product Categories/Family for anti-RUVBL2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated MW: 51kDa
Observed MW: 50kDa
Observed MW: 50kDa
UniProt Protein Name
RuvB-like 2
UniProt Gene Name
RUVBL2
UniProt Synonym Gene Names
INO80J; TIP48; TIP49B; 48 kDa TBP-interacting protein; ECP-51; Reptin 52; TAP54-beta
UniProt Entry Name
RUVB2_HUMAN
Similar Products
Product Notes
The RUVBL2 ruvbl2 (Catalog #AAA283095) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Reptin/RUVBL2 Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Reptin/RUVBL2 can be used in a range of immunoassay formats including, but not limited to, ELISA, WB (Western Blot). Researchers should empirically determine the suitability of the RUVBL2 ruvbl2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LLDRLLIVST TPYSEKDTKQ ILRIRCEEED VEMSEDAYTV LTRIGLETSL RYAIQLITAA SLVCRKRKGT EVQVDDIKRV YSLFLDESRS TQYMKEYQDA F. It is sometimes possible for the material contained within the vial of "Reptin/RUVBL2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.