Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282971_WB13.jpg WB (Western Blot) (Western blot analysis of lysates from RAW264.7 cells, using Rig-I/DDX58 Rabbit mAb (AAA282971) at 1:2000 dilution. Raw264. 7 cells were treated by LPS (1 ug/ml) at 37? for 8 hours.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3s.)

Rabbit anti-Human Rig-I/DDX58 Monoclonal Antibody | anti-RIGI antibody

Rig-I/DDX58 Rabbit mAb

Average rating 0.0
No ratings yet
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity purification
Synonyms
Rig-I/DDX58, Antibody; Rig-I/DDX58 Rabbit mAb; RIG1; DDX58; RIG-I; RLR-1; SGMRT2; Rig-I/DDX58; anti-RIGI antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
FKPRNYQLELALPAMKGKNTIICAPTGCGKTFVSLLICEHHLKKFPQGQKGKVVFFANQIPVYEQQKSVFSKYFERHGYRVTGISGATAENVPVEQIVENNDIIILTPQILVNNLKKGTIPSLSIFTLMIFDECHNTSKQHPYNMIMFNYLDQKLGGSSGPLPQVIGLTASVGVGDAKNTDEALDYICKLCASLDASVIATVKHNLEELEQVVYK
Applicable Applications for anti-RIGI antibody
ELISA, WB (Western Blot)
Cross Reactivity
Human, Mouse
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 241-455 of human Rig-I/DDX58 (NP_055129.2).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

WB (Western Blot)

(Western blot analysis of lysates from RAW264.7 cells, using Rig-I/DDX58 Rabbit mAb (AAA282971) at 1:2000 dilution. Raw264. 7 cells were treated by LPS (1 ug/ml) at 37? for 8 hours.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3s.)

product-image-AAA282971_WB13.jpg WB (Western Blot) (Western blot analysis of lysates from RAW264.7 cells, using Rig-I/DDX58 Rabbit mAb (AAA282971) at 1:2000 dilution. Raw264. 7 cells were treated by LPS (1 ug/ml) at 37? for 8 hours.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3s.)

WB (Western Blot)

(Western blot analysis of various lysates, using Rig-I/DDX58 Rabbit mAb (AAA282971) at 1:2000 dilution. THP-1 cells were treated by LPS (1 ug/ml) at 37? for 6 hours.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3s.)

product-image-AAA282971_WB15.jpg WB (Western Blot) (Western blot analysis of various lysates, using Rig-I/DDX58 Rabbit mAb (AAA282971) at 1:2000 dilution. THP-1 cells were treated by LPS (1 ug/ml) at 37? for 6 hours.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3s.)
Related Product Information for anti-RIGI antibody
DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases which are implicated in a number of cellular processes involving RNA binding and alteration of RNA secondary structure. This gene encodes a protein containing RNA helicase-DEAD box protein motifs and a caspase recruitment domain (CARD). It is involved in viral double-stranded (ds) RNA recognition and the regulation of the antiviral innate immune response. Mutations in this gene are associated with Singleton-Merten syndrome 2.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated MW: 107kDa
Observed MW: 107kDa
UniProt Protein Name
Probable ATP-dependent RNA helicase DDX58
UniProt Gene Name
DDX58
UniProt Synonym Gene Names
RLR-1; RIG-1; RIG-I
UniProt Entry Name
DDX58_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The RIGI ddx58 (Catalog #AAA282971) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Rig-I/DDX58 Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Rig-I/DDX58 can be used in a range of immunoassay formats including, but not limited to, ELISA, WB (Western Blot). Researchers should empirically determine the suitability of the RIGI ddx58 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: FKPRNYQLEL ALPAMKGKNT IICAPTGCGK TFVSLLICEH HLKKFPQGQK GKVVFFANQI PVYEQQKSVF SKYFERHGYR VTGISGATAE NVPVEQIVEN NDIIILTPQI LVNNLKKGTI PSLSIFTLMI FDECHNTSKQ HPYNMIMFNY LDQKLGGSSG PLPQVIGLTA SVGVGDAKNT DEALDYICKL CASLDASVIA TVKHNLEELE QVVYK. It is sometimes possible for the material contained within the vial of "Rig-I/DDX58, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.