Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA26622_APP6.jpg Application Data (Detection limit for recombinant GST tagged ROCK2 is 0.3 ng/ml as a capture antibody.)

Mouse ROCK2 Monoclonal Antibody | anti-ROCK2 antibody

ROCK2 (Rho-Associated, coiled-coil Containing Protein Kinase 2, KIAA0619) (PE)

Average rating 0.0
No ratings yet
Gene Names
ROCK2; ROCK-II
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified
Synonyms
ROCK2, Antibody; ROCK2 (Rho-Associated, coiled-coil Containing Protein Kinase 2, KIAA0619) (PE); Rho-Associated; coiled-coil Containing Protein Kinase 2; KIAA0619; anti-ROCK2 antibody
Ordering
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1.0e+12
Specificity
Recognizes ROCK2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-ROCK2 antibody
IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
ROCK2 (NP_004841, 1279aa-1388aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KPLWHMFKPPPALECRRCHIKCHKDHMDKKEEIIAPCKVYYDISTAKNLLLLANSTEEQQKWVSRLVKKIPKKPPAPDPFARSSPRTSMKIQQNQSIRRPSRQLAPNKPS
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Application Data

(Detection limit for recombinant GST tagged ROCK2 is 0.3 ng/ml as a capture antibody.)

product-image-AAA26622_APP6.jpg Application Data (Detection limit for recombinant GST tagged ROCK2 is 0.3 ng/ml as a capture antibody.)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to ROCK2 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 1.5 ug/ml])

product-image-AAA26622_IHC5.jpg IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to ROCK2 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 1.5 ug/ml])

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to ROCK2 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 1.5 ug/ml])

product-image-AAA26622_IHC4.jpg IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to ROCK2 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 1.5 ug/ml])

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to ROCK2 on HeLa cell. [antibody concentration 30 ug/ml])

product-image-AAA26622_IF3.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to ROCK2 on HeLa cell. [antibody concentration 30 ug/ml])

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to ROCK2 on HeLa cell. [antibody concentration 30 ug/ml])

product-image-AAA26622_IF2.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to ROCK2 on HeLa cell. [antibody concentration 30 ug/ml])

WB (Western Blot)

(ROCK2 monoclonal antibody (M02), clone 1E12 Western Blot analysis of ROCK2 expression in Hela S3 NE (Cat # L013V3).)

product-image-AAA26622_WB.jpg WB (Western Blot) (ROCK2 monoclonal antibody (M02), clone 1E12 Western Blot analysis of ROCK2 expression in Hela S3 NE (Cat # L013V3).)
Related Product Information for anti-ROCK2 antibody
The protein encoded by this gene is a serine/threonine kinase that regulates cytokinesis, smooth muscle contraction, the formation of actin stress fibers and focal adhesions, and the activation of the c-fos serum response element. This protein, which is an isozyme of ROCK1 is a target for the small GTPase Rho. [provided by RefSeq]
Product Categories/Family for anti-ROCK2 antibody
References
1. Vascular hyperpermeability in response to inflammatory mustard oil is mediated by Rho kinase in mice systemically exposed to arsenic. Chen SC, Liu CC, Huang SY, Chiou SJ.Microvasc Res. 2011 Jun 16.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
160,900 Da
NCBI Official Full Name
rho-associated protein kinase 2
NCBI Official Synonym Full Names
Rho-associated, coiled-coil containing protein kinase 2
NCBI Official Symbol
ROCK2
NCBI Official Synonym Symbols
ROCK-II
NCBI Protein Information
rho-associated protein kinase 2; p164 ROCK-2; rho-associated, coiled-coil-containing protein kinase II
UniProt Protein Name
Rho-associated protein kinase 2
UniProt Gene Name
ROCK2
UniProt Synonym Gene Names
KIAA0619; ROCK-II
UniProt Entry Name
ROCK2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The ROCK2 rock2 (Catalog #AAA26622) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's ROCK2 can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ROCK2 rock2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ROCK2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.