Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Have a question or looking for a specific datasheet Manual/COA/MSDS?
Submit a Question

Interested to get a quote about our products?
Request a Quote

WB (Western Blot) (Western blot analysis of TAF7 over-expressed 293 cell line, cotransfected with TAF7 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with TAF7 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Mouse anti-Human TAF7 Monoclonal Antibody | anti-TAF7 antibody

TAF7 (TAF2F, TAFII55, Transcription Initiation Factor TFIID Subunit 7, RNA Polymerase II TBP-associated Factor Subunit F, Transcription Initiation Factor TFIID 55kD Subunit, TAF(II)55, TAFII-55) APC

Gene Names
TAF7; TAF2F; TAFII55
Reactivity
Human
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TAF7; Monoclonal Antibody; TAF7 (TAF2F; TAFII55; Transcription Initiation Factor TFIID Subunit 7; RNA Polymerase II TBP-associated Factor Subunit F; Transcription Initiation Factor TFIID 55kD Subunit; TAF(II)55; TAFII-55) APC; anti-TAF7 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2C5
Specificity
Recognizes human TAF7.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-TAF7 antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa130-224 from human TAF7 (AAH32737) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
FIWNHGITLPLKNVRKRRFRKTAKKKYIESPDVEKEVKRLLSTDAEAVSTRWEIIAEDETKEAENQGLDISSPGMSGHRQGHDSLEHDELREIFN
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

WB (Western Blot)

(Western blot analysis of TAF7 over-expressed 293 cell line, cotransfected with TAF7 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with TAF7 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

WB (Western Blot) (Western blot analysis of TAF7 over-expressed 293 cell line, cotransfected with TAF7 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with TAF7 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Application Data

(Detection limit for recombinant GST tagged TAF7 is ~0.3ng/ml as a capture antibody.)

Application Data (Detection limit for recombinant GST tagged TAF7 is ~0.3ng/ml as a capture antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to TAF7 on HeLa cell. [antibody concentration 10ug/ml])

IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to TAF7 on HeLa cell. [antibody concentration 10ug/ml])

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to TAF7 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 1ug/ml])

IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to TAF7 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 1ug/ml])

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to TAF7 on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3ug/ml])

IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to TAF7 on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3ug/ml])

WB (Western Blot)

(Western Blot analysis of TAF7 expression in transfected 293T cell line by TAF7 monoclonal antibody. Lane 1: TAF7 transfected lysate (40.3kD). Lane 2: Non-transfected lysate.)

WB (Western Blot) (Western Blot analysis of TAF7 expression in transfected 293T cell line by TAF7 monoclonal antibody. Lane 1: TAF7 transfected lysate (40.3kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(TAF7 monoclonal antibody, Western Blot analysis of TAF7 expression in MCF-7.)

WB (Western Blot) (TAF7 monoclonal antibody, Western Blot analysis of TAF7 expression in MCF-7.)
Product Categories/Family for anti-TAF7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
40,259 Da
NCBI Official Full Name
Homo sapiens TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa, mRNA
NCBI Official Synonym Full Names
TATA-box binding protein associated factor 7
NCBI Official Symbol
TAF7
NCBI Official Synonym Symbols
TAF2F; TAFII55
NCBI Protein Information
transcription initiation factor TFIID subunit 7

Similar Products

Product Notes

The TAF7 (Catalog #AAA24679) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TAF7 (TAF2F, TAFII55, Transcription Initiation Factor TFIID Subunit 7, RNA Polymerase II TBP-associated Factor Subunit F, Transcription Initiation Factor TFIID 55kD Subunit, TAF(II)55, TAFII-55) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TAF7 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TAF7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TAF7, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.