Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA125150_IHC11.jpg IHC (Immunohistochemisry) (Figure 3. IHC analysis of TCP1 alpha using anti-TCP1 alpha antibody (M02389).TCP1 alpha was detected in paraffin-embedded section of human placenta tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2ug/ml mouse anti-TCP1 alpha Antibody (M02389) overnight at 4 degree C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

Mouse anti-Human TCP1 alpha Monoclonal Antibody | anti-TCP1 antibody

Anti-TCP1 alpha Antibody (monoclonal, 2E7)

Gene Names
TCP1; CCT1; CCTa; D6S230E; CCT-alpha; TCP-1-alpha
Reactivity
Human
Applications
Flow Cytometry, Functional Assay, Immunocytochemistry, Immunohistochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
TCP1 alpha, Antibody; Anti-TCP1 alpha Antibody (monoclonal, 2E7); T-complex protein 1 subunit alpha; TCP-1-alpha; CCT-alpha; TCP1; CCT1; CCTA; T-complex 1; anti-TCP1 antibody
Ordering
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1
Clone Number
2E7
Specificity
No cross reactivity with other proteins.
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized
Sequence Length
556
Applicable Applications for anti-TCP1 antibody
FCM/FACS (Flow Cytometry), ICC (Immunocytochemistry), IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human TCP1 alpha (515-551aa KFATEAAITILRIDDLIKLHPESKDDKHGSYEDAVHS), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Relevant Detection Systems
It is recommended to use an Enhanced Chemiluminescent Kit with anti-Rabbit IgG (MBS176460) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (MBS176453) for IHC-P, IHC-F and ICC.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time.
Avoid repeated freezing and thawing.

IHC (Immunohistochemisry)

(Figure 3. IHC analysis of TCP1 alpha using anti-TCP1 alpha antibody (M02389).TCP1 alpha was detected in paraffin-embedded section of human placenta tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2ug/ml mouse anti-TCP1 alpha Antibody (M02389) overnight at 4 degree C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

product-image-AAA125150_IHC11.jpg IHC (Immunohistochemisry) (Figure 3. IHC analysis of TCP1 alpha using anti-TCP1 alpha antibody (M02389).TCP1 alpha was detected in paraffin-embedded section of human placenta tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2ug/ml mouse anti-TCP1 alpha Antibody (M02389) overnight at 4 degree C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

IHC (Immunohiostchemistry)

(Figure 3. IHC analysis of TCP1 alpha using anti-TCP1 alpha antibody (M02389).TCP1 alpha was detected in paraffin-embedded section of human placenta tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2ug/ml mouse anti-TCP1 alpha Antibody (M02389) overnight at 4 degree C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

product-image-AAA125150_IHC13.jpg IHC (Immunohiostchemistry) (Figure 3. IHC analysis of TCP1 alpha using anti-TCP1 alpha antibody (M02389).TCP1 alpha was detected in paraffin-embedded section of human placenta tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2ug/ml mouse anti-TCP1 alpha Antibody (M02389) overnight at 4 degree C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

WB (Western Blot)

(Figure 1. Western blot analysis of TCP1 alpha using anti-TCP1 alpha antibody (M02389).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.Lane 1: human Hela whole cell lysates,Lane 2: human MCF-7 whole cell lysates,Lane 3: human COLO-320 whole cell lysates,Lane 4: human HepG2 whole cell lysates,Lane 5: human A431 whole cell lysates,Lane 6: human HT1080 whole cell lysates.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/TBS for 1.5 hour at RT. The membrane was incubated with mouse anti-TCP1 alpha antigen affinity purified monoclonal antibody at 0.5 ug/ml overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a Biotin Conjugated goat anti-mouse IgG secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system.)

product-image-AAA125150_WB15.jpg WB (Western Blot) (Figure 1. Western blot analysis of TCP1 alpha using anti-TCP1 alpha antibody (M02389).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.Lane 1: human Hela whole cell lysates,Lane 2: human MCF-7 whole cell lysates,Lane 3: human COLO-320 whole cell lysates,Lane 4: human HepG2 whole cell lysates,Lane 5: human A431 whole cell lysates,Lane 6: human HT1080 whole cell lysates.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/TBS for 1.5 hour at RT. The membrane was incubated with mouse anti-TCP1 alpha antigen affinity purified monoclonal antibody at 0.5 ug/ml overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a Biotin Conjugated goat anti-mouse IgG secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system.)
Related Product Information for anti-TCP1 antibody
Description: Mouse IgG monoclonal antibody for TCP1 alpha detection. Tested with WB, IHC-P, IHC-F, ICC, FCM in Human.
Background: T-complex protein 1 subunit alpha is a protein that in humans is encoded by the TCP1 gene. The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants of this gene, encoding different isoforms, have been characterized. In addition, three pseudogenes that appear to be derived from this gene have been found.
References
1. "Entrez Gene: TCP1 t-complex 1". 2. Fonatsch C, Gradl G, Ragoussis J, Ziegler A (Oct 1987). "Assignment of the TCP1 locus to the long arm of human chromosome 6 by in situ hybridization". Cytogenet Cell Genet 45 (2): 109-12. 3. Willison K, Kelly A, Dudley K, Goodfellow P, Spurr N, Groves V, Gorman P, Sheer D, Trowsdale J (Nov 1987)."The human homologue of the mouse t-complex gene, TCP1, is located on chromosome 6 but is not near the HLA region". EMBO J 6 (7): 1967-74.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60,344 Da
NCBI Official Full Name
T-complex protein 1 subunit alpha isoform a
NCBI Official Synonym Full Names
t-complex 1
NCBI Official Symbol
TCP1
NCBI Official Synonym Symbols
CCT1; CCTa; D6S230E; CCT-alpha; TCP-1-alpha
NCBI Protein Information
T-complex protein 1 subunit alpha
UniProt Protein Name
T-complex protein 1 subunit alpha
UniProt Gene Name
TCP1
UniProt Synonym Gene Names
CCT1; CCTA; TCP-1-alpha

Similar Products

Product Notes

The TCP1 tcp1 (Catalog #AAA125150) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Anti-TCP1 alpha Antibody (monoclonal, 2E7) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TCP1 alpha can be used in a range of immunoassay formats including, but not limited to, FCM/FACS (Flow Cytometry), ICC (Immunocytochemistry), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the TCP1 tcp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TCP1 alpha, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.