TCP1 alpha Polyclonal Antibody | anti-TCP1 alpha antibody

Anti-TCP1 alpha Antibody

Cat. Num. AAA46575

• Gene Names: TCP1; CCT1; CCTa; D6S230E; CCT-alpha; TCP-1-alpha
• Reactivity: Human, Mouse, Rat
• Applications: Immunohistochemistry, Western Blot
• Purity: Immunogen Affinity Purified
• Synonyms: TCP1 alpha, Antibody; Anti-TCP1 alpha Antibody; T-complex protein 1 subunit alpha; AI528772; c-cpn; CCT alpha; CCT; CCT-alpha; CCT1; Ccta; CCTalpha; D6S230E; MGC133746; p63; T complex 1; T complex protein 1 alpha subunit; T complex protein 1; T-complex homolog TCP1; T-complex protein 1 subunit alpha B; Tailless complex polypeptide 1; Tailless complex polypeptide 1A; Tailless complex polypeptide 1B; TCP 1 alpha; Tcp-1; TCP-1-alpha; TCP1; TCPA_HUMAN; Tp63; TRic; t-complex 1; anti-TCP1 alpha antibody

• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Purity/Purification: Immunogen Affinity Purified
• Form/Format: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 556

• Applicable Applications for anti-TCP1 alpha antibody: IHC (Immunohistochemistry), WB (Western Blot)
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human TCP1 alpha (515-551aa KFATEAAITILRIDDLIKLHPESKDDKHGSYEDAVHS), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids.
• Ig Type: Rabbit IgG
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Preparation and Storage: At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohistochemistry)

(Anti- TCP1 alpha Picoband antibody, AAA46575, IHC(P)IHC(P): Human Testis Tissue)

IHC (Immunohistochemisry)

(Anti- TCP1 alpha Picoband antibody, AAA46575, IHC(P)IHC(P): Rat Ovary Tissue)

IHC (Immunohiostchemistry)

(Anti- TCP1 alpha Picoband antibody, AAA46575, IHC(P)IHC(P): Mouse Testis Tissue)

WB (Western Blot)

(Anti- TCP1 alpha Picoband antibody, AAA46575, Western blottingAll lanes: Anti TCP1 alpha (AAA46575) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Rat Testis Tissue Lysate at 50ugLane 3: Mouse Spleen Tissue Lysate at 50ugLane 4: Mouse Thymus Tissue Lysate at 50ugLane 5: HELA Whole Cell Lysate at 40ugLane 6: MCF-7 Whole Cell Lysate at 40ugPredicted bind size: 60KDObserved bind size: 60KD)

Related Product Information for anti-TCP1 alpha antibody

Description: Rabbit IgG polyclonal antibody for T-complex protein 1 subunit alpha(TCP1) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: T-complex protein 1 subunit alpha is a protein that in humans is encoded by the TCP1 gene. The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants of this gene, encoding different isoforms, have been characterized. In addition, three pseudogenes that appear to be derived from this gene have been found.

References

1. "Entrez Gene: TCP1 t-complex 1". 2. Fonatsch C, Gradl G, Ragoussis J, Ziegler A (Oct 1987). "Assignment of the TCP1 locus to the long arm of human chromosome 6 by in situ hybridization". Cytogenet Cell Genet 45 (2): 109-12. 3. Willison K, Kelly A, Dudley K, Goodfellow P, Spurr N, Groves V, Gorman P, Sheer D, Trowsdale J (Nov 1987)."The human homologue of the mouse t-complex gene, TCP1, is located on chromosome 6 but is not near the HLA region". EMBO J 6 (7): 1967-74.

NCBI and Uniprot Product Information

• NCBI GI #: 57863257
• NCBI GeneID: 6950
• NCBI Accession #: NP_110379.2
• NCBI GenBank Nucleotide #: NM_030752.2
• UniProt Accession #: P17987; Q15556; Q5TCM3; E1P5B2
• Molecular Weight: 60,344 Da
• NCBI Official Full Name: T-complex protein 1 subunit alpha isoform a
• NCBI Official Synonym Full Names: t-complex 1
• NCBI Official Symbol: TCP1
• NCBI Official Synonym Symbols: CCT1; CCTa; D6S230E; CCT-alpha; TCP-1-alpha
• NCBI Protein Information: T-complex protein 1 subunit alpha
• UniProt Protein Name: T-complex protein 1 subunit alpha
• UniProt Gene Name: TCP1
• UniProt Synonym Gene Names: CCT1; CCTA; TCP-1-alpha
• UniProt Entry Name: TCPA_HUMAN